FuNGI

Q2U6E3

Protein Details

Accession

Q2U6E3

Localization Confidence

High

Confidence Score

16.8

NoLS Segment(s)

Position	Sequence	Protein Nature
704-730	VTFSPKKPQAKSTKRSVRWKDDEQDGS	Hydrophilic
758-778	AVPHRTTRKAGRQTKTTPSGS	Hydrophilic

NLS Segment(s)

Position	Sequence
659-659	K
687-719	PGKGSPRRRRLGGGRKSVTFSPKKPQAKSTKRS

Subcellular Location(s)

nucl 13, mito 11, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR027640 Kinesin-like_fam IPR019821 Kinesin_motor_CS IPR001752 Kinesin_motor_dom IPR036961 Kinesin_motor_dom_sf IPR027417 P-loop_NTPase
Gene Ontology	GO:0035371 C:microtubule plus-end GO:0061673 C:mitotic spindle astral microtubule GO:0005880 C:nuclear microtubule GO:0005524 F:ATP binding GO:0008017 F:microtubule binding GO:0008574 F:plus-end-directed microtubule motor activity GO:0070463 F:tubulin-dependent ATPase activity GO:0000132 P:establishment of mitotic spindle orientation GO:0045144 P:meiotic sister chromatid segregation GO:0090307 P:mitotic spindle assembly GO:0051228 P:mitotic spindle disassembly GO:0031115 P:negative regulation of microtubule polymerization GO:0030473 P:nuclear migration along microtubule GO:0070462 P:plus-end specific microtubule depolymerization GO:0032888 P:regulation of mitotic spindle elongation
Pfam	View protein in Pfam PF00225 Kinesin
PROSITE	View protein in PROSITE PS00411 KINESIN_MOTOR_1 PS50067 KINESIN_MOTOR_2
CDD	cd01370 KISc_KIP3_like

Amino Acid Sequences

MAIPSDASSITVAVRVRPFTIREAAQISKCEDGPLFLGDGSLAGAPTPKLNQKGIRSIIKVIDDRCLVFDPPEDSPVQKFSKSVVPNGKRVKDQTFAFDRIFDQNASQGEVYEATTRTLLDSVLDGYNATVFAYGATGCGKTHTITGTAQQPGIIFMTMQELFERIDERSGEKATEISLSYLEIYNETIRDLLVPGGSKGGLMLREDSNKSVSVSGLSSHHPQNVQQVMDMIMKGNECRTMSPTEANATSSRSHAVLQINIAQKDRNADVNEPHTMATLSIIDLAGSERASATKNRGERLFEGANINKSLLALGSCINALCDPRKRNHVPYRNSKLTRLLKFSLGGNCKTVMIVCVSPSSQHFDETQNTLRYANRAKNIQTKVTRNVFNVNRHVKDFLVKIDEQMNLINELKAQQKDYERIAFAKFKKQTEKKDAVVREGISRIRNAYEHSLPERQERTANMLKSRQISRRIGILSSWIAAFDSVCANSENEVPLANLQAIRKTAQGVLLELESSRQHYHQRLARSTWDRGINSAVEHAVRQLHDFGINDNGDLANLHREAELLKSNTERDAFSAVAEQEKAGEAETVQLLLQAQFEAISAIEDIMQMSEEEAVEAGKSILSKMLDSCSTATSSLVKPDGSLPAAQPFSPSKAMSPKPKKRVSLAALPAGKTLAAPISLASTAPASPGKGSPRRRRLGGGRKSVTFSPKKPQAKSTKRSVRWKDDEQDGSLAEFQKTPQKPRAQLFPEGPQGSPTTPAVPHRTTRKAGRQTKTTPSGSVRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.21
3	0.23
4	0.27
5	0.29
6	0.3
7	0.36
8	0.33
9	0.33
10	0.37
11	0.4
12	0.39
13	0.4
14	0.38
15	0.35
16	0.34
17	0.32
18	0.27
19	0.23
20	0.21
21	0.19
22	0.18
23	0.14
24	0.14
25	0.11
26	0.11
27	0.1
28	0.08
29	0.06
30	0.05
31	0.07
32	0.07
33	0.1
34	0.15
35	0.2
36	0.24
37	0.31
38	0.38
39	0.43
40	0.52
41	0.57
42	0.6
43	0.57
44	0.57
45	0.55
46	0.54
47	0.52
48	0.44
49	0.43
50	0.37
51	0.34
52	0.33
53	0.31
54	0.25
55	0.22
56	0.24
57	0.22
58	0.22
59	0.24
60	0.22
61	0.21
62	0.23
63	0.28
64	0.28
65	0.26
66	0.24
67	0.25
68	0.32
69	0.33
70	0.4
71	0.44
72	0.46
73	0.55
74	0.63
75	0.65
76	0.62
77	0.64
78	0.61
79	0.57
80	0.53
81	0.53
82	0.5
83	0.49
84	0.44
85	0.41
86	0.38
87	0.35
88	0.35
89	0.27
90	0.21
91	0.21
92	0.21
93	0.23
94	0.2
95	0.16
96	0.15
97	0.15
98	0.16
99	0.15
100	0.15
101	0.13
102	0.14
103	0.13
104	0.13
105	0.13
106	0.12
107	0.09
108	0.09
109	0.1
110	0.1
111	0.1
112	0.09
113	0.09
114	0.09
115	0.09
116	0.08
117	0.05
118	0.05
119	0.05
120	0.06
121	0.05
122	0.06
123	0.07
124	0.08
125	0.07
126	0.09
127	0.1
128	0.1
129	0.13
130	0.13
131	0.14
132	0.15
133	0.19
134	0.23
135	0.24
136	0.23
137	0.22
138	0.21
139	0.19
140	0.19
141	0.15
142	0.09
143	0.07
144	0.12
145	0.12
146	0.12
147	0.11
148	0.1
149	0.11
150	0.12
151	0.13
152	0.09
153	0.12
154	0.12
155	0.15
156	0.17
157	0.18
158	0.18
159	0.16
160	0.16
161	0.14
162	0.15
163	0.13
164	0.11
165	0.1
166	0.1
167	0.11
168	0.11
169	0.11
170	0.09
171	0.1
172	0.11
173	0.1
174	0.1
175	0.09
176	0.08
177	0.09
178	0.09
179	0.08
180	0.08
181	0.08
182	0.08
183	0.09
184	0.09
185	0.08
186	0.08
187	0.09
188	0.09
189	0.1
190	0.12
191	0.14
192	0.18
193	0.2
194	0.21
195	0.21
196	0.2
197	0.2
198	0.18
199	0.16
200	0.13
201	0.12
202	0.12
203	0.12
204	0.14
205	0.17
206	0.18
207	0.21
208	0.2
209	0.21
210	0.27
211	0.29
212	0.27
213	0.23
214	0.22
215	0.21
216	0.22
217	0.21
218	0.14
219	0.11
220	0.11
221	0.11
222	0.11
223	0.12
224	0.11
225	0.12
226	0.15
227	0.17
228	0.19
229	0.21
230	0.21
231	0.21
232	0.21
233	0.22
234	0.19
235	0.19
236	0.18
237	0.16
238	0.16
239	0.14
240	0.14
241	0.16
242	0.18
243	0.16
244	0.17
245	0.22
246	0.25
247	0.26
248	0.26
249	0.22
250	0.2
251	0.22
252	0.22
253	0.21
254	0.19
255	0.2
256	0.23
257	0.26
258	0.27
259	0.24
260	0.23
261	0.18
262	0.16
263	0.14
264	0.11
265	0.08
266	0.06
267	0.06
268	0.06
269	0.05
270	0.05
271	0.06
272	0.05
273	0.05
274	0.05
275	0.04
276	0.05
277	0.07
278	0.09
279	0.12
280	0.17
281	0.2
282	0.23
283	0.25
284	0.27
285	0.27
286	0.32
287	0.29
288	0.26
289	0.27
290	0.27
291	0.27
292	0.24
293	0.23
294	0.16
295	0.15
296	0.13
297	0.09
298	0.07
299	0.05
300	0.05
301	0.06
302	0.06
303	0.06
304	0.06
305	0.06
306	0.07
307	0.11
308	0.17
309	0.19
310	0.22
311	0.32
312	0.36
313	0.45
314	0.54
315	0.6
316	0.61
317	0.69
318	0.76
319	0.76
320	0.74
321	0.66
322	0.65
323	0.64
324	0.6
325	0.55
326	0.47
327	0.39
328	0.38
329	0.39
330	0.36
331	0.31
332	0.28
333	0.24
334	0.22
335	0.21
336	0.2
337	0.17
338	0.1
339	0.09
340	0.08
341	0.07
342	0.08
343	0.08
344	0.09
345	0.09
346	0.14
347	0.12
348	0.13
349	0.14
350	0.16
351	0.18
352	0.21
353	0.25
354	0.21
355	0.22
356	0.22
357	0.21
358	0.21
359	0.24
360	0.25
361	0.24
362	0.25
363	0.28
364	0.35
365	0.38
366	0.41
367	0.42
368	0.41
369	0.45
370	0.48
371	0.47
372	0.4
373	0.45
374	0.43
375	0.42
376	0.46
377	0.45
378	0.41
379	0.39
380	0.39
381	0.32
382	0.3
383	0.26
384	0.19
385	0.17
386	0.16
387	0.16
388	0.18
389	0.18
390	0.15
391	0.15
392	0.14
393	0.11
394	0.12
395	0.11
396	0.08
397	0.1
398	0.13
399	0.13
400	0.14
401	0.15
402	0.17
403	0.2
404	0.23
405	0.24
406	0.2
407	0.21
408	0.23
409	0.26
410	0.25
411	0.31
412	0.33
413	0.34
414	0.43
415	0.49
416	0.55
417	0.57
418	0.61
419	0.57
420	0.6
421	0.58
422	0.51
423	0.47
424	0.39
425	0.32
426	0.29
427	0.28
428	0.21
429	0.2
430	0.18
431	0.16
432	0.16
433	0.16
434	0.18
435	0.18
436	0.2
437	0.23
438	0.26
439	0.26
440	0.3
441	0.3
442	0.26
443	0.26
444	0.24
445	0.28
446	0.3
447	0.31
448	0.3
449	0.31
450	0.33
451	0.35
452	0.4
453	0.39
454	0.4
455	0.41
456	0.38
457	0.4
458	0.38
459	0.34
460	0.29
461	0.26
462	0.19
463	0.16
464	0.15
465	0.1
466	0.08
467	0.08
468	0.08
469	0.05
470	0.06
471	0.05
472	0.06
473	0.07
474	0.07
475	0.08
476	0.09
477	0.09
478	0.08
479	0.09
480	0.08
481	0.08
482	0.08
483	0.08
484	0.09
485	0.08
486	0.1
487	0.11
488	0.12
489	0.12
490	0.13
491	0.13
492	0.15
493	0.15
494	0.13
495	0.13
496	0.12
497	0.12
498	0.1
499	0.11
500	0.08
501	0.1
502	0.1
503	0.11
504	0.16
505	0.19
506	0.27
507	0.3
508	0.37
509	0.39
510	0.41
511	0.48
512	0.48
513	0.47
514	0.46
515	0.47
516	0.4
517	0.37
518	0.36
519	0.28
520	0.23
521	0.21
522	0.17
523	0.11
524	0.11
525	0.11
526	0.11
527	0.11
528	0.12
529	0.12
530	0.11
531	0.13
532	0.13
533	0.13
534	0.17
535	0.16
536	0.15
537	0.14
538	0.13
539	0.11
540	0.11
541	0.11
542	0.09
543	0.09
544	0.1
545	0.09
546	0.09
547	0.1
548	0.13
549	0.18
550	0.15
551	0.17
552	0.18
553	0.19
554	0.21
555	0.22
556	0.19
557	0.15
558	0.17
559	0.15
560	0.14
561	0.17
562	0.15
563	0.15
564	0.15
565	0.13
566	0.11
567	0.11
568	0.11
569	0.08
570	0.08
571	0.06
572	0.08
573	0.08
574	0.08
575	0.07
576	0.07
577	0.07
578	0.08
579	0.08
580	0.06
581	0.06
582	0.05
583	0.06
584	0.05
585	0.05
586	0.05
587	0.05
588	0.05
589	0.05
590	0.05
591	0.05
592	0.05
593	0.05
594	0.05
595	0.05
596	0.05
597	0.05
598	0.05
599	0.05
600	0.05
601	0.05
602	0.05
603	0.05
604	0.05
605	0.05
606	0.05
607	0.08
608	0.09
609	0.1
610	0.11
611	0.14
612	0.14
613	0.16
614	0.17
615	0.15
616	0.16
617	0.15
618	0.15
619	0.15
620	0.16
621	0.18
622	0.19
623	0.17
624	0.17
625	0.19
626	0.21
627	0.19
628	0.19
629	0.17
630	0.21
631	0.22
632	0.21
633	0.22
634	0.21
635	0.24
636	0.26
637	0.25
638	0.23
639	0.31
640	0.38
641	0.46
642	0.55
643	0.61
644	0.68
645	0.75
646	0.76
647	0.73
648	0.76
649	0.71
650	0.7
651	0.65
652	0.64
653	0.59
654	0.55
655	0.5
656	0.4
657	0.33
658	0.23
659	0.18
660	0.11
661	0.08
662	0.08
663	0.07
664	0.09
665	0.1
666	0.1
667	0.09
668	0.09
669	0.09
670	0.11
671	0.12
672	0.11
673	0.12
674	0.17
675	0.25
676	0.33
677	0.44
678	0.52
679	0.61
680	0.67
681	0.69
682	0.73
683	0.75
684	0.77
685	0.77
686	0.77
687	0.72
688	0.68
689	0.69
690	0.65
691	0.64
692	0.61
693	0.55
694	0.55
695	0.59
696	0.65
697	0.65
698	0.71
699	0.72
700	0.75
701	0.78
702	0.79
703	0.8
704	0.81
705	0.87
706	0.87
707	0.87
708	0.85
709	0.86
710	0.82
711	0.8
712	0.75
713	0.67
714	0.6
715	0.5
716	0.43
717	0.37
718	0.32
719	0.24
720	0.21
721	0.19
722	0.26
723	0.31
724	0.36
725	0.42
726	0.49
727	0.55
728	0.6
729	0.69
730	0.65
731	0.68
732	0.66
733	0.65
734	0.65
735	0.59
736	0.53
737	0.45
738	0.43
739	0.36
740	0.34
741	0.28
742	0.22
743	0.23
744	0.29
745	0.34
746	0.36
747	0.42
748	0.48
749	0.54
750	0.57
751	0.64
752	0.69
753	0.72
754	0.77
755	0.79
756	0.79
757	0.79
758	0.82
759	0.81
760	0.73
761	0.68

Q2U6E3

3D AlphaFold-predicted Structure Viewer