Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2U6E3

Protein Details
Accession Q2U6E3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
704-730VTFSPKKPQAKSTKRSVRWKDDEQDGSHydrophilic
758-778AVPHRTTRKAGRQTKTTPSGSHydrophilic
NLS Segment(s)
PositionSequence
659-659K
687-719PGKGSPRRRRLGGGRKSVTFSPKKPQAKSTKRS
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027640  Kinesin-like_fam  
IPR019821  Kinesin_motor_CS  
IPR001752  Kinesin_motor_dom  
IPR036961  Kinesin_motor_dom_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0035371  C:microtubule plus-end  
GO:0061673  C:mitotic spindle astral microtubule  
GO:0005880  C:nuclear microtubule  
GO:0005524  F:ATP binding  
GO:0008017  F:microtubule binding  
GO:0008574  F:plus-end-directed microtubule motor activity  
GO:0070463  F:tubulin-dependent ATPase activity  
GO:0000132  P:establishment of mitotic spindle orientation  
GO:0045144  P:meiotic sister chromatid segregation  
GO:0090307  P:mitotic spindle assembly  
GO:0051228  P:mitotic spindle disassembly  
GO:0031115  P:negative regulation of microtubule polymerization  
GO:0030473  P:nuclear migration along microtubule  
GO:0070462  P:plus-end specific microtubule depolymerization  
GO:0032888  P:regulation of mitotic spindle elongation  
Pfam View protein in Pfam  
PF00225  Kinesin  
PROSITE View protein in PROSITE  
PS00411  KINESIN_MOTOR_1  
PS50067  KINESIN_MOTOR_2  
CDD cd01370  KISc_KIP3_like  
Amino Acid Sequences MAIPSDASSITVAVRVRPFTIREAAQISKCEDGPLFLGDGSLAGAPTPKLNQKGIRSIIKVIDDRCLVFDPPEDSPVQKFSKSVVPNGKRVKDQTFAFDRIFDQNASQGEVYEATTRTLLDSVLDGYNATVFAYGATGCGKTHTITGTAQQPGIIFMTMQELFERIDERSGEKATEISLSYLEIYNETIRDLLVPGGSKGGLMLREDSNKSVSVSGLSSHHPQNVQQVMDMIMKGNECRTMSPTEANATSSRSHAVLQINIAQKDRNADVNEPHTMATLSIIDLAGSERASATKNRGERLFEGANINKSLLALGSCINALCDPRKRNHVPYRNSKLTRLLKFSLGGNCKTVMIVCVSPSSQHFDETQNTLRYANRAKNIQTKVTRNVFNVNRHVKDFLVKIDEQMNLINELKAQQKDYERIAFAKFKKQTEKKDAVVREGISRIRNAYEHSLPERQERTANMLKSRQISRRIGILSSWIAAFDSVCANSENEVPLANLQAIRKTAQGVLLELESSRQHYHQRLARSTWDRGINSAVEHAVRQLHDFGINDNGDLANLHREAELLKSNTERDAFSAVAEQEKAGEAETVQLLLQAQFEAISAIEDIMQMSEEEAVEAGKSILSKMLDSCSTATSSLVKPDGSLPAAQPFSPSKAMSPKPKKRVSLAALPAGKTLAAPISLASTAPASPGKGSPRRRRLGGGRKSVTFSPKKPQAKSTKRSVRWKDDEQDGSLAEFQKTPQKPRAQLFPEGPQGSPTTPAVPHRTTRKAGRQTKTTPSGSVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.27
5 0.29
6 0.3
7 0.36
8 0.33
9 0.33
10 0.37
11 0.4
12 0.39
13 0.4
14 0.38
15 0.35
16 0.34
17 0.32
18 0.27
19 0.23
20 0.21
21 0.19
22 0.18
23 0.14
24 0.14
25 0.11
26 0.11
27 0.1
28 0.08
29 0.06
30 0.05
31 0.07
32 0.07
33 0.1
34 0.15
35 0.2
36 0.24
37 0.31
38 0.38
39 0.43
40 0.52
41 0.57
42 0.6
43 0.57
44 0.57
45 0.55
46 0.54
47 0.52
48 0.44
49 0.43
50 0.37
51 0.34
52 0.33
53 0.31
54 0.25
55 0.22
56 0.24
57 0.22
58 0.22
59 0.24
60 0.22
61 0.21
62 0.23
63 0.28
64 0.28
65 0.26
66 0.24
67 0.25
68 0.32
69 0.33
70 0.4
71 0.44
72 0.46
73 0.55
74 0.63
75 0.65
76 0.62
77 0.64
78 0.61
79 0.57
80 0.53
81 0.53
82 0.5
83 0.49
84 0.44
85 0.41
86 0.38
87 0.35
88 0.35
89 0.27
90 0.21
91 0.21
92 0.21
93 0.23
94 0.2
95 0.16
96 0.15
97 0.15
98 0.16
99 0.15
100 0.15
101 0.13
102 0.14
103 0.13
104 0.13
105 0.13
106 0.12
107 0.09
108 0.09
109 0.1
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.05
118 0.05
119 0.05
120 0.06
121 0.05
122 0.06
123 0.07
124 0.08
125 0.07
126 0.09
127 0.1
128 0.1
129 0.13
130 0.13
131 0.14
132 0.15
133 0.19
134 0.23
135 0.24
136 0.23
137 0.22
138 0.21
139 0.19
140 0.19
141 0.15
142 0.09
143 0.07
144 0.12
145 0.12
146 0.12
147 0.11
148 0.1
149 0.11
150 0.12
151 0.13
152 0.09
153 0.12
154 0.12
155 0.15
156 0.17
157 0.18
158 0.18
159 0.16
160 0.16
161 0.14
162 0.15
163 0.13
164 0.11
165 0.1
166 0.1
167 0.11
168 0.11
169 0.11
170 0.09
171 0.1
172 0.11
173 0.1
174 0.1
175 0.09
176 0.08
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.09
184 0.09
185 0.08
186 0.08
187 0.09
188 0.09
189 0.1
190 0.12
191 0.14
192 0.18
193 0.2
194 0.21
195 0.21
196 0.2
197 0.2
198 0.18
199 0.16
200 0.13
201 0.12
202 0.12
203 0.12
204 0.14
205 0.17
206 0.18
207 0.21
208 0.2
209 0.21
210 0.27
211 0.29
212 0.27
213 0.23
214 0.22
215 0.21
216 0.22
217 0.21
218 0.14
219 0.11
220 0.11
221 0.11
222 0.11
223 0.12
224 0.11
225 0.12
226 0.15
227 0.17
228 0.19
229 0.21
230 0.21
231 0.21
232 0.21
233 0.22
234 0.19
235 0.19
236 0.18
237 0.16
238 0.16
239 0.14
240 0.14
241 0.16
242 0.18
243 0.16
244 0.17
245 0.22
246 0.25
247 0.26
248 0.26
249 0.22
250 0.2
251 0.22
252 0.22
253 0.21
254 0.19
255 0.2
256 0.23
257 0.26
258 0.27
259 0.24
260 0.23
261 0.18
262 0.16
263 0.14
264 0.11
265 0.08
266 0.06
267 0.06
268 0.06
269 0.05
270 0.05
271 0.06
272 0.05
273 0.05
274 0.05
275 0.04
276 0.05
277 0.07
278 0.09
279 0.12
280 0.17
281 0.2
282 0.23
283 0.25
284 0.27
285 0.27
286 0.32
287 0.29
288 0.26
289 0.27
290 0.27
291 0.27
292 0.24
293 0.23
294 0.16
295 0.15
296 0.13
297 0.09
298 0.07
299 0.05
300 0.05
301 0.06
302 0.06
303 0.06
304 0.06
305 0.06
306 0.07
307 0.11
308 0.17
309 0.19
310 0.22
311 0.32
312 0.36
313 0.45
314 0.54
315 0.6
316 0.61
317 0.69
318 0.76
319 0.76
320 0.74
321 0.66
322 0.65
323 0.64
324 0.6
325 0.55
326 0.47
327 0.39
328 0.38
329 0.39
330 0.36
331 0.31
332 0.28
333 0.24
334 0.22
335 0.21
336 0.2
337 0.17
338 0.1
339 0.09
340 0.08
341 0.07
342 0.08
343 0.08
344 0.09
345 0.09
346 0.14
347 0.12
348 0.13
349 0.14
350 0.16
351 0.18
352 0.21
353 0.25
354 0.21
355 0.22
356 0.22
357 0.21
358 0.21
359 0.24
360 0.25
361 0.24
362 0.25
363 0.28
364 0.35
365 0.38
366 0.41
367 0.42
368 0.41
369 0.45
370 0.48
371 0.47
372 0.4
373 0.45
374 0.43
375 0.42
376 0.46
377 0.45
378 0.41
379 0.39
380 0.39
381 0.32
382 0.3
383 0.26
384 0.19
385 0.17
386 0.16
387 0.16
388 0.18
389 0.18
390 0.15
391 0.15
392 0.14
393 0.11
394 0.12
395 0.11
396 0.08
397 0.1
398 0.13
399 0.13
400 0.14
401 0.15
402 0.17
403 0.2
404 0.23
405 0.24
406 0.2
407 0.21
408 0.23
409 0.26
410 0.25
411 0.31
412 0.33
413 0.34
414 0.43
415 0.49
416 0.55
417 0.57
418 0.61
419 0.57
420 0.6
421 0.58
422 0.51
423 0.47
424 0.39
425 0.32
426 0.29
427 0.28
428 0.21
429 0.2
430 0.18
431 0.16
432 0.16
433 0.16
434 0.18
435 0.18
436 0.2
437 0.23
438 0.26
439 0.26
440 0.3
441 0.3
442 0.26
443 0.26
444 0.24
445 0.28
446 0.3
447 0.31
448 0.3
449 0.31
450 0.33
451 0.35
452 0.4
453 0.39
454 0.4
455 0.41
456 0.38
457 0.4
458 0.38
459 0.34
460 0.29
461 0.26
462 0.19
463 0.16
464 0.15
465 0.1
466 0.08
467 0.08
468 0.08
469 0.05
470 0.06
471 0.05
472 0.06
473 0.07
474 0.07
475 0.08
476 0.09
477 0.09
478 0.08
479 0.09
480 0.08
481 0.08
482 0.08
483 0.08
484 0.09
485 0.08
486 0.1
487 0.11
488 0.12
489 0.12
490 0.13
491 0.13
492 0.15
493 0.15
494 0.13
495 0.13
496 0.12
497 0.12
498 0.1
499 0.11
500 0.08
501 0.1
502 0.1
503 0.11
504 0.16
505 0.19
506 0.27
507 0.3
508 0.37
509 0.39
510 0.41
511 0.48
512 0.48
513 0.47
514 0.46
515 0.47
516 0.4
517 0.37
518 0.36
519 0.28
520 0.23
521 0.21
522 0.17
523 0.11
524 0.11
525 0.11
526 0.11
527 0.11
528 0.12
529 0.12
530 0.11
531 0.13
532 0.13
533 0.13
534 0.17
535 0.16
536 0.15
537 0.14
538 0.13
539 0.11
540 0.11
541 0.11
542 0.09
543 0.09
544 0.1
545 0.09
546 0.09
547 0.1
548 0.13
549 0.18
550 0.15
551 0.17
552 0.18
553 0.19
554 0.21
555 0.22
556 0.19
557 0.15
558 0.17
559 0.15
560 0.14
561 0.17
562 0.15
563 0.15
564 0.15
565 0.13
566 0.11
567 0.11
568 0.11
569 0.08
570 0.08
571 0.06
572 0.08
573 0.08
574 0.08
575 0.07
576 0.07
577 0.07
578 0.08
579 0.08
580 0.06
581 0.06
582 0.05
583 0.06
584 0.05
585 0.05
586 0.05
587 0.05
588 0.05
589 0.05
590 0.05
591 0.05
592 0.05
593 0.05
594 0.05
595 0.05
596 0.05
597 0.05
598 0.05
599 0.05
600 0.05
601 0.05
602 0.05
603 0.05
604 0.05
605 0.05
606 0.05
607 0.08
608 0.09
609 0.1
610 0.11
611 0.14
612 0.14
613 0.16
614 0.17
615 0.15
616 0.16
617 0.15
618 0.15
619 0.15
620 0.16
621 0.18
622 0.19
623 0.17
624 0.17
625 0.19
626 0.21
627 0.19
628 0.19
629 0.17
630 0.21
631 0.22
632 0.21
633 0.22
634 0.21
635 0.24
636 0.26
637 0.25
638 0.23
639 0.31
640 0.38
641 0.46
642 0.55
643 0.61
644 0.68
645 0.75
646 0.76
647 0.73
648 0.76
649 0.71
650 0.7
651 0.65
652 0.64
653 0.59
654 0.55
655 0.5
656 0.4
657 0.33
658 0.23
659 0.18
660 0.11
661 0.08
662 0.08
663 0.07
664 0.09
665 0.1
666 0.1
667 0.09
668 0.09
669 0.09
670 0.11
671 0.12
672 0.11
673 0.12
674 0.17
675 0.25
676 0.33
677 0.44
678 0.52
679 0.61
680 0.67
681 0.69
682 0.73
683 0.75
684 0.77
685 0.77
686 0.77
687 0.72
688 0.68
689 0.69
690 0.65
691 0.64
692 0.61
693 0.55
694 0.55
695 0.59
696 0.65
697 0.65
698 0.71
699 0.72
700 0.75
701 0.78
702 0.79
703 0.8
704 0.81
705 0.87
706 0.87
707 0.87
708 0.85
709 0.86
710 0.82
711 0.8
712 0.75
713 0.67
714 0.6
715 0.5
716 0.43
717 0.37
718 0.32
719 0.24
720 0.21
721 0.19
722 0.26
723 0.31
724 0.36
725 0.42
726 0.49
727 0.55
728 0.6
729 0.69
730 0.65
731 0.68
732 0.66
733 0.65
734 0.65
735 0.59
736 0.53
737 0.45
738 0.43
739 0.36
740 0.34
741 0.28
742 0.22
743 0.23
744 0.29
745 0.34
746 0.36
747 0.42
748 0.48
749 0.54
750 0.57
751 0.64
752 0.69
753 0.72
754 0.77
755 0.79
756 0.79
757 0.79
758 0.82
759 0.81
760 0.73
761 0.68