Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167FLM0

Protein Details
Accession A0A167FLM0   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
17-40ARAAASKKVRRKRSELARNKISKQHydrophilic
NLS Segment(s)
PositionSequence
11-76SKNRLAARAAASKKVRRKRSELARNKISKQDIARGARPGILPTSGPRAKVSAKKARKLEKKTGYAL
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MPSVKNPNGPSKNRLAARAAASKKVRRKRSELARNKISKQDIARGARPGILPTSGPRAKVSAKKARKLEKKTGYALRRRMEAEGEQVMQDAPDMDAEVERQLNGEDDMEIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.51
3 0.47
4 0.47
5 0.51
6 0.45
7 0.45
8 0.49
9 0.53
10 0.59
11 0.64
12 0.68
13 0.65
14 0.71
15 0.72
16 0.77
17 0.8
18 0.81
19 0.81
20 0.81
21 0.81
22 0.76
23 0.72
24 0.63
25 0.57
26 0.49
27 0.47
28 0.44
29 0.43
30 0.43
31 0.38
32 0.36
33 0.34
34 0.32
35 0.25
36 0.18
37 0.14
38 0.12
39 0.11
40 0.18
41 0.17
42 0.18
43 0.17
44 0.18
45 0.22
46 0.27
47 0.34
48 0.36
49 0.42
50 0.48
51 0.55
52 0.63
53 0.69
54 0.7
55 0.73
56 0.71
57 0.7
58 0.7
59 0.72
60 0.69
61 0.68
62 0.68
63 0.6
64 0.55
65 0.51
66 0.46
67 0.41
68 0.35
69 0.31
70 0.26
71 0.24
72 0.21
73 0.2
74 0.18
75 0.14
76 0.13
77 0.08
78 0.06
79 0.05
80 0.06
81 0.06
82 0.06
83 0.07
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.11
90 0.11
91 0.11