Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167CB29

Protein Details
Accession A0A167CB29   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-63GERSGRLQRKKERAQRPAAAHydrophilic
NLS Segment(s)
PositionSequence
46-60RSGRLQRKKERAQRP
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MRGPSCARQTDRQTNLQVLRLRDNAARANHPSAHFPRRAHEENGERSGRLQRKKERAQRPAAAGAAAGAGAGVGDDVVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.56
4 0.51
5 0.44
6 0.44
7 0.38
8 0.37
9 0.32
10 0.33
11 0.32
12 0.3
13 0.31
14 0.29
15 0.31
16 0.32
17 0.31
18 0.34
19 0.33
20 0.36
21 0.37
22 0.34
23 0.34
24 0.38
25 0.41
26 0.38
27 0.38
28 0.39
29 0.39
30 0.44
31 0.4
32 0.33
33 0.31
34 0.37
35 0.37
36 0.38
37 0.42
38 0.46
39 0.56
40 0.66
41 0.75
42 0.77
43 0.79
44 0.8
45 0.78
46 0.74
47 0.68
48 0.58
49 0.48
50 0.38
51 0.29
52 0.2
53 0.14
54 0.09
55 0.04
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02