Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167KQE0

Protein Details
Accession A0A167KQE0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-61SVNRPSFRPNKAPKKGNKTPSTIHydrophilic
NLS Segment(s)
PositionSequence
45-56FRPNKAPKKGNK
Subcellular Location(s) extr 17, mito 4, E.R. 2, cyto_mito 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MALSRLAVITLSCVVILLYSCACSANPIPGGSLGKPAGSVNRPSFRPNKAPKKGNKTPSTIKSATVKTPPPGRHNTPAAPGGSTPEHYETVVDYIDDADLKAKMETFQNRQYYRGYPNVDVLRNTGKFTQVELQKLHGAFDKLEKAIRPGKKPASNEHYETVVDYIEDADLKAKMETFQNRMYYRGYPGVSILGKTGKFTQSELQVVQEAFNELEKAIRPGKTPAPGNGKTPAPGRGNTPAPGRGNTPASNGKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.08
7 0.08
8 0.09
9 0.09
10 0.12
11 0.13
12 0.17
13 0.19
14 0.19
15 0.19
16 0.22
17 0.25
18 0.22
19 0.26
20 0.2
21 0.18
22 0.18
23 0.18
24 0.21
25 0.22
26 0.28
27 0.3
28 0.36
29 0.37
30 0.42
31 0.48
32 0.48
33 0.55
34 0.59
35 0.64
36 0.67
37 0.75
38 0.79
39 0.83
40 0.85
41 0.85
42 0.81
43 0.77
44 0.77
45 0.73
46 0.72
47 0.63
48 0.57
49 0.53
50 0.5
51 0.47
52 0.44
53 0.41
54 0.38
55 0.45
56 0.47
57 0.47
58 0.52
59 0.53
60 0.54
61 0.56
62 0.53
63 0.49
64 0.47
65 0.41
66 0.34
67 0.28
68 0.24
69 0.2
70 0.19
71 0.17
72 0.15
73 0.15
74 0.15
75 0.15
76 0.12
77 0.12
78 0.11
79 0.09
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.07
91 0.12
92 0.17
93 0.21
94 0.28
95 0.35
96 0.35
97 0.37
98 0.38
99 0.37
100 0.36
101 0.37
102 0.33
103 0.27
104 0.31
105 0.33
106 0.32
107 0.29
108 0.27
109 0.26
110 0.23
111 0.24
112 0.19
113 0.17
114 0.16
115 0.17
116 0.22
117 0.19
118 0.21
119 0.21
120 0.22
121 0.23
122 0.23
123 0.22
124 0.18
125 0.16
126 0.13
127 0.15
128 0.16
129 0.13
130 0.15
131 0.14
132 0.16
133 0.23
134 0.27
135 0.28
136 0.33
137 0.4
138 0.44
139 0.47
140 0.51
141 0.51
142 0.51
143 0.5
144 0.45
145 0.38
146 0.33
147 0.31
148 0.23
149 0.15
150 0.11
151 0.08
152 0.07
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.07
161 0.08
162 0.12
163 0.17
164 0.2
165 0.25
166 0.31
167 0.31
168 0.33
169 0.34
170 0.32
171 0.31
172 0.32
173 0.27
174 0.21
175 0.21
176 0.24
177 0.22
178 0.2
179 0.18
180 0.17
181 0.16
182 0.18
183 0.21
184 0.19
185 0.2
186 0.21
187 0.24
188 0.25
189 0.28
190 0.27
191 0.25
192 0.25
193 0.24
194 0.22
195 0.18
196 0.15
197 0.12
198 0.13
199 0.11
200 0.09
201 0.11
202 0.11
203 0.14
204 0.17
205 0.19
206 0.2
207 0.25
208 0.31
209 0.36
210 0.39
211 0.43
212 0.48
213 0.48
214 0.5
215 0.5
216 0.46
217 0.42
218 0.41
219 0.41
220 0.36
221 0.35
222 0.36
223 0.39
224 0.41
225 0.42
226 0.44
227 0.43
228 0.43
229 0.44
230 0.42
231 0.4
232 0.42
233 0.39
234 0.41