Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167H6J3

Protein Details
Accession A0A167H6J3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
128-147GPVSKLVKRRRENKGLKPEPBasic
NLS Segment(s)
PositionSequence
136-138RRR
Subcellular Location(s) plas 20, vacu 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007272  Sulf_transp  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF04143  Sulf_transp  
Amino Acid Sequences MAATAISGAVFGAAMMAGGFHQPSLVISQLKFENWHMFQTFLAATATSAVIYAIAERRGYAKISSRNSSPLGFFSSYDGNVIGGSLLGAGMALSGSCPGTLYAQLAAGVQTGFYALGGAIIGGILWSGPVSKLVKRRRENKGLKPEPGLVSEQLGLSRGATLLLLEAASIAVIAVTTMYRPPSPTAKIPGAVGGLLIGAAQLVSILTRKSMVGISGSYEEMGNYFWWLISGADANAKPASYQNLLFASGVASGAWGLLRLIPGLASGPVDEVSPMLAMSGGVLVAVGSRIAGGCTSGHGISGISLLSTSSVITITSAFAVGSVVAPLVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.09
12 0.12
13 0.14
14 0.14
15 0.19
16 0.2
17 0.22
18 0.23
19 0.24
20 0.29
21 0.27
22 0.32
23 0.29
24 0.28
25 0.27
26 0.28
27 0.25
28 0.17
29 0.16
30 0.11
31 0.1
32 0.1
33 0.11
34 0.07
35 0.07
36 0.06
37 0.05
38 0.05
39 0.07
40 0.09
41 0.1
42 0.11
43 0.11
44 0.13
45 0.15
46 0.17
47 0.17
48 0.23
49 0.3
50 0.36
51 0.39
52 0.39
53 0.42
54 0.43
55 0.41
56 0.35
57 0.28
58 0.28
59 0.25
60 0.23
61 0.21
62 0.22
63 0.2
64 0.19
65 0.17
66 0.12
67 0.1
68 0.1
69 0.07
70 0.04
71 0.04
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.06
87 0.07
88 0.08
89 0.07
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.06
117 0.08
118 0.12
119 0.21
120 0.3
121 0.4
122 0.47
123 0.56
124 0.62
125 0.71
126 0.77
127 0.78
128 0.81
129 0.77
130 0.72
131 0.66
132 0.61
133 0.51
134 0.44
135 0.35
136 0.24
137 0.2
138 0.17
139 0.14
140 0.11
141 0.1
142 0.08
143 0.06
144 0.06
145 0.05
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.05
166 0.05
167 0.06
168 0.09
169 0.13
170 0.16
171 0.19
172 0.23
173 0.24
174 0.24
175 0.23
176 0.22
177 0.18
178 0.15
179 0.12
180 0.07
181 0.05
182 0.04
183 0.04
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.03
192 0.03
193 0.04
194 0.05
195 0.05
196 0.06
197 0.07
198 0.07
199 0.08
200 0.08
201 0.09
202 0.1
203 0.1
204 0.1
205 0.09
206 0.08
207 0.08
208 0.08
209 0.06
210 0.06
211 0.06
212 0.05
213 0.05
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.1
220 0.1
221 0.12
222 0.12
223 0.11
224 0.11
225 0.12
226 0.16
227 0.14
228 0.15
229 0.16
230 0.17
231 0.18
232 0.18
233 0.16
234 0.13
235 0.11
236 0.1
237 0.07
238 0.06
239 0.04
240 0.05
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.06
251 0.06
252 0.06
253 0.06
254 0.07
255 0.07
256 0.07
257 0.07
258 0.06
259 0.06
260 0.06
261 0.06
262 0.05
263 0.04
264 0.04
265 0.04
266 0.04
267 0.03
268 0.03
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.04
277 0.04
278 0.04
279 0.05
280 0.05
281 0.07
282 0.1
283 0.1
284 0.1
285 0.1
286 0.1
287 0.09
288 0.1
289 0.08
290 0.05
291 0.06
292 0.05
293 0.06
294 0.06
295 0.06
296 0.05
297 0.06
298 0.06
299 0.07
300 0.07
301 0.07
302 0.08
303 0.08
304 0.07
305 0.07
306 0.07
307 0.07
308 0.06
309 0.06