Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167A7B7

Protein Details
Accession A0A167A7B7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAKKKKSCRARQASSSLGKTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, nucl 4, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MAKKKKSCRARQASSSLGKTPDSTTISNTDIKFPGNLRNSIASVALASQPIKFIVGPDRTEFTLHSHLVAQQSPILEVLVSSGTGVVQKTIDWEHVDESAFLCFSQHIYTGQYDPLKLETKFHWRTAEDEWKNRVLCHIKIYIFASCYGVEALMDSSFARLKSDLGGAKTNKAAIAAFPGILRFCCCCSIGCPAQVMDLVKKSAASLVFDLLKLDDFRTLVRDYPDLAIDVLFRMVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.66
4 0.58
5 0.49
6 0.42
7 0.37
8 0.35
9 0.31
10 0.28
11 0.27
12 0.28
13 0.3
14 0.34
15 0.33
16 0.3
17 0.27
18 0.27
19 0.27
20 0.25
21 0.31
22 0.31
23 0.32
24 0.3
25 0.32
26 0.31
27 0.3
28 0.28
29 0.19
30 0.14
31 0.14
32 0.12
33 0.1
34 0.1
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.1
41 0.16
42 0.2
43 0.22
44 0.23
45 0.26
46 0.25
47 0.26
48 0.25
49 0.23
50 0.24
51 0.22
52 0.2
53 0.19
54 0.2
55 0.22
56 0.22
57 0.18
58 0.14
59 0.14
60 0.13
61 0.12
62 0.1
63 0.07
64 0.06
65 0.06
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.07
77 0.08
78 0.09
79 0.09
80 0.1
81 0.11
82 0.12
83 0.12
84 0.1
85 0.1
86 0.09
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.08
96 0.09
97 0.1
98 0.13
99 0.13
100 0.12
101 0.12
102 0.14
103 0.15
104 0.15
105 0.16
106 0.16
107 0.25
108 0.27
109 0.29
110 0.29
111 0.26
112 0.29
113 0.33
114 0.41
115 0.35
116 0.37
117 0.38
118 0.4
119 0.39
120 0.37
121 0.36
122 0.29
123 0.27
124 0.26
125 0.27
126 0.24
127 0.25
128 0.27
129 0.23
130 0.2
131 0.19
132 0.17
133 0.12
134 0.12
135 0.1
136 0.08
137 0.07
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.06
144 0.07
145 0.08
146 0.08
147 0.08
148 0.08
149 0.09
150 0.14
151 0.16
152 0.16
153 0.23
154 0.23
155 0.25
156 0.25
157 0.25
158 0.21
159 0.19
160 0.16
161 0.1
162 0.14
163 0.12
164 0.12
165 0.11
166 0.12
167 0.12
168 0.12
169 0.14
170 0.1
171 0.11
172 0.13
173 0.14
174 0.14
175 0.16
176 0.24
177 0.26
178 0.26
179 0.26
180 0.24
181 0.24
182 0.26
183 0.25
184 0.21
185 0.2
186 0.19
187 0.17
188 0.17
189 0.16
190 0.17
191 0.17
192 0.16
193 0.14
194 0.17
195 0.18
196 0.18
197 0.18
198 0.15
199 0.17
200 0.15
201 0.14
202 0.13
203 0.13
204 0.14
205 0.17
206 0.18
207 0.19
208 0.21
209 0.22
210 0.22
211 0.23
212 0.24
213 0.21
214 0.2
215 0.17
216 0.14
217 0.13