Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167I6X0

Protein Details
Accession A0A167I6X0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-41KEDKEPKTSGKRKAKAKAVKEPSKQDBasic
NLS Segment(s)
PositionSequence
20-35EPKTSGKRKAKAKAVK
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019601  Oxoglutarate/Fe-dep_Oase_C  
IPR043044  TPA1/Ofd1_C  
Gene Ontology GO:0016706  F:2-oxoglutarate-dependent dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0031418  F:L-ascorbic acid binding  
Pfam View protein in Pfam  
PF10637  Ofd1_CTDD  
Amino Acid Sequences MTPTTGWGSDDDQDAKEDKEPKTSGKRKAKAKAVKEPSKQDEEDDQVGGVEVYMAGDDDDADEDAAVYKSSGDDDNMLFFQTASWNKLAIVLRDSGALKFVKYVSRRAKGDRWDITGVYEVQDLDNEEDESNGEGAALGESDGEEFEGFSDSEESESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.24
4 0.28
5 0.25
6 0.31
7 0.32
8 0.38
9 0.48
10 0.54
11 0.6
12 0.64
13 0.71
14 0.72
15 0.8
16 0.83
17 0.81
18 0.81
19 0.81
20 0.81
21 0.83
22 0.8
23 0.8
24 0.75
25 0.72
26 0.64
27 0.56
28 0.5
29 0.45
30 0.4
31 0.31
32 0.25
33 0.19
34 0.18
35 0.15
36 0.1
37 0.05
38 0.03
39 0.03
40 0.03
41 0.03
42 0.02
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.05
60 0.06
61 0.07
62 0.08
63 0.08
64 0.08
65 0.07
66 0.07
67 0.06
68 0.09
69 0.1
70 0.11
71 0.11
72 0.11
73 0.11
74 0.16
75 0.17
76 0.14
77 0.14
78 0.13
79 0.13
80 0.15
81 0.15
82 0.1
83 0.12
84 0.11
85 0.1
86 0.1
87 0.11
88 0.16
89 0.17
90 0.26
91 0.32
92 0.39
93 0.42
94 0.46
95 0.51
96 0.52
97 0.6
98 0.55
99 0.51
100 0.46
101 0.44
102 0.4
103 0.36
104 0.29
105 0.21
106 0.18
107 0.13
108 0.11
109 0.11
110 0.11
111 0.1
112 0.11
113 0.11
114 0.1
115 0.1
116 0.11
117 0.11
118 0.1
119 0.08
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.07
135 0.07
136 0.08
137 0.09
138 0.09