Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UEJ3

Protein Details
Accession Q2UEJ3   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22FSRRGSQRAFRERKERHVREBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG aor:AO090026000595  -  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MFFSRRGSQRAFRERKERHVRELEEKVNNLEQASSNLVADNERLKRELARFTTENEILRATSGSGDRTHNHSDEPTTTGPLKYTPTDFYSELVPKGEPSRLHRVSTCAKTGEKLLGAGATWDLIQGHELFKRGLVDIKDVSERLKNITQCDGQGPAFPEAEVLKAIEESAAANDDDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.82
4 0.77
5 0.75
6 0.76
7 0.74
8 0.72
9 0.75
10 0.72
11 0.66
12 0.62
13 0.56
14 0.49
15 0.45
16 0.36
17 0.28
18 0.22
19 0.18
20 0.2
21 0.17
22 0.14
23 0.14
24 0.14
25 0.13
26 0.13
27 0.17
28 0.17
29 0.18
30 0.19
31 0.19
32 0.23
33 0.26
34 0.33
35 0.3
36 0.33
37 0.33
38 0.35
39 0.4
40 0.38
41 0.36
42 0.29
43 0.26
44 0.19
45 0.19
46 0.16
47 0.1
48 0.09
49 0.09
50 0.1
51 0.11
52 0.14
53 0.15
54 0.2
55 0.22
56 0.21
57 0.21
58 0.2
59 0.2
60 0.19
61 0.22
62 0.17
63 0.16
64 0.16
65 0.16
66 0.15
67 0.15
68 0.16
69 0.13
70 0.14
71 0.14
72 0.15
73 0.18
74 0.18
75 0.17
76 0.18
77 0.18
78 0.17
79 0.15
80 0.13
81 0.11
82 0.12
83 0.14
84 0.14
85 0.18
86 0.28
87 0.29
88 0.31
89 0.31
90 0.34
91 0.38
92 0.39
93 0.36
94 0.29
95 0.27
96 0.26
97 0.27
98 0.24
99 0.18
100 0.14
101 0.12
102 0.09
103 0.09
104 0.08
105 0.07
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.06
113 0.08
114 0.09
115 0.1
116 0.1
117 0.11
118 0.12
119 0.12
120 0.16
121 0.15
122 0.18
123 0.18
124 0.2
125 0.21
126 0.2
127 0.22
128 0.21
129 0.21
130 0.22
131 0.27
132 0.27
133 0.28
134 0.34
135 0.34
136 0.31
137 0.33
138 0.31
139 0.25
140 0.27
141 0.27
142 0.23
143 0.22
144 0.2
145 0.19
146 0.16
147 0.17
148 0.14
149 0.11
150 0.09
151 0.09
152 0.09
153 0.07
154 0.07
155 0.07
156 0.07
157 0.09
158 0.08