Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086TID8

Protein Details
Accession A0A086TID8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-121TTVEQVKKTYRKPKGKKDRPKKAGHDRNYPSBasic
NLS Segment(s)
PositionSequence
98-117KTYRKPKGKKDRPKKAGHDR
Subcellular Location(s) nucl 16.5, mito_nucl 12.833, mito 8, cyto_mito 5.833
Family & Domain DBs
Amino Acid Sequences DFNYKAPVVLEHSAKVTLSHPAKKHDSDLSTIQSNMASSTCFFDTFAHELVLHGDSGDMWESIYYDALGIKHGNMKERYLLTLEEPATTRTTVEQVKKTYRKPKGKKDRPKKAGHDRNYPSDKPKAQMSNKDRGYKSDDGYKSGGIKHFGKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.17
4 0.22
5 0.26
6 0.32
7 0.34
8 0.4
9 0.46
10 0.47
11 0.5
12 0.48
13 0.44
14 0.41
15 0.42
16 0.39
17 0.35
18 0.33
19 0.29
20 0.23
21 0.21
22 0.17
23 0.13
24 0.09
25 0.08
26 0.11
27 0.11
28 0.11
29 0.11
30 0.11
31 0.15
32 0.17
33 0.17
34 0.15
35 0.14
36 0.14
37 0.15
38 0.15
39 0.1
40 0.08
41 0.06
42 0.05
43 0.06
44 0.07
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.1
59 0.11
60 0.16
61 0.16
62 0.17
63 0.18
64 0.19
65 0.19
66 0.17
67 0.16
68 0.12
69 0.15
70 0.15
71 0.13
72 0.13
73 0.14
74 0.14
75 0.13
76 0.12
77 0.09
78 0.12
79 0.16
80 0.2
81 0.24
82 0.27
83 0.37
84 0.43
85 0.5
86 0.57
87 0.62
88 0.68
89 0.73
90 0.8
91 0.82
92 0.87
93 0.91
94 0.92
95 0.93
96 0.91
97 0.92
98 0.9
99 0.9
100 0.9
101 0.86
102 0.85
103 0.79
104 0.8
105 0.78
106 0.7
107 0.64
108 0.63
109 0.58
110 0.5
111 0.53
112 0.53
113 0.52
114 0.6
115 0.61
116 0.62
117 0.67
118 0.72
119 0.65
120 0.6
121 0.6
122 0.55
123 0.52
124 0.52
125 0.47
126 0.42
127 0.44
128 0.42
129 0.37
130 0.37
131 0.37
132 0.33