Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A086TIN7

Protein Details
Accession A0A086TIN7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MATPLECKKGQHKKGQHKKGQFKKGQRKKGQRKKGHRKKGHRKKGHRKKGQCCIVQNBasic
NLS Segment(s)
PositionSequence
9-49KGQHKKGQHKKGQFKKGQRKKGQRKKGHRKKGHRKKGHRKK
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MATPLECKKGQHKKGQHKKGQFKKGQRKKGQRKKGHRKKGHRKKGHRKKGQCCIVQNSNCRVLKEPSWSILQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.89
3 0.88
4 0.87
5 0.9
6 0.9
7 0.9
8 0.87
9 0.87
10 0.88
11 0.88
12 0.89
13 0.88
14 0.89
15 0.9
16 0.92
17 0.92
18 0.91
19 0.93
20 0.93
21 0.94
22 0.94
23 0.92
24 0.93
25 0.93
26 0.94
27 0.94
28 0.93
29 0.93
30 0.94
31 0.95
32 0.95
33 0.94
34 0.93
35 0.91
36 0.91
37 0.89
38 0.84
39 0.79
40 0.76
41 0.75
42 0.71
43 0.68
44 0.63
45 0.63
46 0.58
47 0.54
48 0.5
49 0.46
50 0.44
51 0.46
52 0.44
53 0.38