Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178F2E5

Protein Details
Accession A0A178F2E5   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-28TPRYQFSLRRGDNKKSKIRRDIGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037475  Sos7  
Gene Ontology GO:0000776  C:kinetochore  
GO:0034501  P:protein localization to kinetochore  
Amino Acid Sequences MPIFTPRYQFSLRRGDNKKSKIRRDIGVDVDGPCTMVDTVYSDALAQIQALDKETPADTLAIIRISEPIGTSDGTATSERSPSKRTSDVSTDAYDNPTPATLEADLTHYKELFSKLRFSYLEQVTKEKFLRAIVGDPPLVVAHSDNVELEAELAQIKEELQRRKEEVRISVEEMEKMSRDLAKRYENVQLQTTQLSELPASIANLEETISRLRDAQSAQLQERSSLSPSQNLPLEATLRLLADKDAELTSLKRTLASSETALVRKTGEAEALERELAVLEKKRNEVIAQAKEAQRRKLQGESDGLEEMGRWYAGAEQILKSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.72
4 0.77
5 0.81
6 0.8
7 0.84
8 0.84
9 0.84
10 0.8
11 0.78
12 0.75
13 0.7
14 0.64
15 0.56
16 0.47
17 0.42
18 0.35
19 0.27
20 0.19
21 0.16
22 0.11
23 0.08
24 0.07
25 0.09
26 0.11
27 0.1
28 0.11
29 0.09
30 0.09
31 0.1
32 0.1
33 0.07
34 0.06
35 0.08
36 0.08
37 0.11
38 0.11
39 0.1
40 0.12
41 0.13
42 0.13
43 0.11
44 0.11
45 0.09
46 0.1
47 0.11
48 0.1
49 0.1
50 0.09
51 0.09
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.09
61 0.11
62 0.11
63 0.11
64 0.11
65 0.16
66 0.18
67 0.2
68 0.24
69 0.25
70 0.3
71 0.34
72 0.35
73 0.36
74 0.39
75 0.41
76 0.41
77 0.39
78 0.36
79 0.31
80 0.32
81 0.27
82 0.21
83 0.17
84 0.14
85 0.12
86 0.1
87 0.11
88 0.08
89 0.09
90 0.09
91 0.12
92 0.13
93 0.14
94 0.15
95 0.13
96 0.13
97 0.14
98 0.17
99 0.18
100 0.19
101 0.23
102 0.23
103 0.27
104 0.28
105 0.28
106 0.33
107 0.33
108 0.37
109 0.33
110 0.36
111 0.33
112 0.36
113 0.34
114 0.27
115 0.23
116 0.17
117 0.19
118 0.16
119 0.17
120 0.15
121 0.16
122 0.15
123 0.14
124 0.14
125 0.11
126 0.1
127 0.08
128 0.06
129 0.05
130 0.05
131 0.06
132 0.05
133 0.06
134 0.06
135 0.05
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.08
145 0.14
146 0.18
147 0.2
148 0.23
149 0.26
150 0.29
151 0.33
152 0.31
153 0.31
154 0.32
155 0.32
156 0.32
157 0.32
158 0.3
159 0.26
160 0.24
161 0.2
162 0.14
163 0.12
164 0.11
165 0.1
166 0.11
167 0.13
168 0.17
169 0.2
170 0.22
171 0.24
172 0.3
173 0.3
174 0.31
175 0.3
176 0.27
177 0.24
178 0.23
179 0.21
180 0.15
181 0.12
182 0.11
183 0.08
184 0.07
185 0.07
186 0.07
187 0.07
188 0.06
189 0.06
190 0.05
191 0.05
192 0.06
193 0.05
194 0.06
195 0.07
196 0.08
197 0.08
198 0.09
199 0.1
200 0.12
201 0.13
202 0.17
203 0.21
204 0.24
205 0.25
206 0.28
207 0.28
208 0.26
209 0.27
210 0.23
211 0.2
212 0.21
213 0.2
214 0.21
215 0.22
216 0.25
217 0.25
218 0.24
219 0.23
220 0.2
221 0.21
222 0.16
223 0.16
224 0.13
225 0.11
226 0.1
227 0.1
228 0.09
229 0.08
230 0.08
231 0.09
232 0.08
233 0.09
234 0.1
235 0.11
236 0.13
237 0.15
238 0.15
239 0.14
240 0.14
241 0.16
242 0.18
243 0.19
244 0.18
245 0.19
246 0.22
247 0.23
248 0.23
249 0.21
250 0.19
251 0.17
252 0.18
253 0.15
254 0.13
255 0.13
256 0.14
257 0.17
258 0.17
259 0.17
260 0.14
261 0.13
262 0.11
263 0.11
264 0.14
265 0.16
266 0.2
267 0.24
268 0.27
269 0.29
270 0.3
271 0.3
272 0.33
273 0.37
274 0.38
275 0.39
276 0.44
277 0.47
278 0.53
279 0.58
280 0.57
281 0.55
282 0.54
283 0.54
284 0.55
285 0.53
286 0.52
287 0.53
288 0.49
289 0.45
290 0.4
291 0.36
292 0.28
293 0.24
294 0.19
295 0.14
296 0.11
297 0.08
298 0.07
299 0.1
300 0.12
301 0.15
302 0.16
303 0.15