Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LRS5

Protein Details
Accession E2LRS5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
228-254MVAQKERREKKKVDTKASKGRKIRYEVBasic
NLS Segment(s)
PositionSequence
232-250KERREKKKVDTKASKGRKI
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025160  AATF  
IPR039223  AATF/Bfr2  
IPR012617  AATF_C  
Gene Ontology GO:0005634  C:nucleus  
KEGG mpr:MPER_09697  -  
Pfam View protein in Pfam  
PF13339  AATF-Che1  
PF08164  TRAUB  
Amino Acid Sequences MGEREESYVRHDEIILEGDTPAETDGVSATLRQKRDEDWKKGVAVSKQIVNDGFKSTFEEANLLSQEIMSLQERLASNESLPLPPRKKRRTDIESLPGSETSLIEASNFATVFEHSVHPHLLQTLAKWSSKIQAVAPSVLLPANRNAFSKDRQQIKGAVQLIDEHLIDQVKLLSRTRVWRGKGERLGVSPSDGDEKQDMEIFDDTDFYQQLLRDVIDSRDASGATNWMVAQKERREKKKVDTKASKGRKIRYEVHDKLRNFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.14
4 0.13
5 0.12
6 0.12
7 0.11
8 0.1
9 0.06
10 0.05
11 0.05
12 0.06
13 0.06
14 0.07
15 0.08
16 0.16
17 0.21
18 0.23
19 0.26
20 0.27
21 0.31
22 0.42
23 0.5
24 0.51
25 0.52
26 0.55
27 0.54
28 0.56
29 0.56
30 0.49
31 0.46
32 0.41
33 0.38
34 0.35
35 0.35
36 0.34
37 0.31
38 0.29
39 0.26
40 0.23
41 0.19
42 0.22
43 0.22
44 0.22
45 0.2
46 0.19
47 0.15
48 0.18
49 0.18
50 0.14
51 0.12
52 0.1
53 0.1
54 0.09
55 0.1
56 0.08
57 0.07
58 0.07
59 0.11
60 0.12
61 0.14
62 0.17
63 0.15
64 0.14
65 0.18
66 0.19
67 0.17
68 0.19
69 0.25
70 0.28
71 0.35
72 0.46
73 0.5
74 0.57
75 0.62
76 0.7
77 0.69
78 0.71
79 0.72
80 0.7
81 0.66
82 0.59
83 0.53
84 0.43
85 0.35
86 0.28
87 0.2
88 0.12
89 0.09
90 0.07
91 0.06
92 0.06
93 0.06
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.07
100 0.08
101 0.09
102 0.08
103 0.1
104 0.11
105 0.1
106 0.1
107 0.09
108 0.1
109 0.09
110 0.08
111 0.12
112 0.14
113 0.14
114 0.14
115 0.14
116 0.16
117 0.17
118 0.18
119 0.14
120 0.17
121 0.18
122 0.18
123 0.17
124 0.14
125 0.13
126 0.13
127 0.12
128 0.07
129 0.09
130 0.11
131 0.12
132 0.13
133 0.15
134 0.17
135 0.2
136 0.28
137 0.32
138 0.37
139 0.37
140 0.39
141 0.4
142 0.39
143 0.43
144 0.37
145 0.3
146 0.23
147 0.22
148 0.21
149 0.18
150 0.16
151 0.09
152 0.08
153 0.08
154 0.08
155 0.07
156 0.08
157 0.09
158 0.11
159 0.11
160 0.13
161 0.16
162 0.21
163 0.29
164 0.34
165 0.35
166 0.42
167 0.47
168 0.54
169 0.57
170 0.55
171 0.5
172 0.45
173 0.46
174 0.37
175 0.32
176 0.23
177 0.19
178 0.19
179 0.17
180 0.17
181 0.15
182 0.15
183 0.15
184 0.17
185 0.16
186 0.14
187 0.15
188 0.13
189 0.12
190 0.13
191 0.12
192 0.11
193 0.12
194 0.09
195 0.1
196 0.1
197 0.11
198 0.11
199 0.11
200 0.11
201 0.12
202 0.13
203 0.17
204 0.17
205 0.17
206 0.17
207 0.17
208 0.17
209 0.16
210 0.16
211 0.11
212 0.12
213 0.11
214 0.12
215 0.14
216 0.16
217 0.23
218 0.3
219 0.4
220 0.49
221 0.57
222 0.62
223 0.66
224 0.74
225 0.77
226 0.78
227 0.79
228 0.8
229 0.82
230 0.85
231 0.89
232 0.88
233 0.85
234 0.84
235 0.81
236 0.78
237 0.78
238 0.76
239 0.77
240 0.76
241 0.78
242 0.78