Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EZA1

Protein Details
Accession A0A178EZA1   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-82DYMARKGCFGRRKRRKKKGSTGEKGSFRRRGBasic
NLS Segment(s)
PositionSequence
61-87GRRKRRKKKGSTGEKGSFRRRGAARPE
Subcellular Location(s) mito 19, cyto 4, nucl 2
Family & Domain DBs
Amino Acid Sequences MPKVEPVHPTALLQHMPLAHAGSVGYRVPRWSDGDNGGFSLRFILNPDQVTDYMARKGCFGRRKRRKKKGSTGEKGSFRRRGAARPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.16
4 0.16
5 0.15
6 0.1
7 0.09
8 0.09
9 0.07
10 0.09
11 0.09
12 0.1
13 0.09
14 0.1
15 0.12
16 0.14
17 0.17
18 0.16
19 0.19
20 0.21
21 0.23
22 0.22
23 0.21
24 0.19
25 0.16
26 0.14
27 0.13
28 0.09
29 0.07
30 0.09
31 0.1
32 0.12
33 0.13
34 0.14
35 0.13
36 0.13
37 0.15
38 0.14
39 0.13
40 0.15
41 0.17
42 0.17
43 0.16
44 0.19
45 0.25
46 0.33
47 0.4
48 0.48
49 0.57
50 0.68
51 0.78
52 0.87
53 0.9
54 0.92
55 0.95
56 0.94
57 0.95
58 0.93
59 0.92
60 0.89
61 0.88
62 0.84
63 0.81
64 0.78
65 0.68
66 0.67
67 0.6