Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EQ45

Protein Details
Accession A0A178EQ45   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-35EYWEENRAYKKRKLERRKNNPPKQRCFDWMHydrophilic
NLS Segment(s)
PositionSequence
15-27KKRKLERRKNNPP
Subcellular Location(s) nucl 16, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MGEIGEYWEENRAYKKRKLERRKNNPPKQRCFDWMITSGISYAKNRSSFKTYRHIRPVTLASGTGARVIGVGSVELKVPRSPDNPEVNTLVLDDVLHIPGAICNGFSPQLLGGSTSFGEPLQGYDDDNQPSYYATTFCGLWRLVLNGNPEGETQLAEARKNGSIFTLSVYINEEDEEHIFGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.53
3 0.58
4 0.69
5 0.79
6 0.82
7 0.85
8 0.89
9 0.94
10 0.95
11 0.96
12 0.95
13 0.94
14 0.93
15 0.9
16 0.84
17 0.78
18 0.74
19 0.68
20 0.63
21 0.55
22 0.47
23 0.4
24 0.34
25 0.29
26 0.23
27 0.2
28 0.16
29 0.16
30 0.19
31 0.25
32 0.26
33 0.3
34 0.36
35 0.38
36 0.42
37 0.49
38 0.51
39 0.55
40 0.62
41 0.6
42 0.53
43 0.54
44 0.52
45 0.44
46 0.38
47 0.29
48 0.2
49 0.19
50 0.18
51 0.14
52 0.1
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.07
65 0.09
66 0.12
67 0.13
68 0.17
69 0.23
70 0.3
71 0.3
72 0.31
73 0.3
74 0.28
75 0.26
76 0.22
77 0.15
78 0.08
79 0.07
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.04
89 0.04
90 0.04
91 0.05
92 0.06
93 0.05
94 0.06
95 0.05
96 0.06
97 0.06
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.06
107 0.06
108 0.08
109 0.08
110 0.09
111 0.11
112 0.15
113 0.15
114 0.16
115 0.16
116 0.13
117 0.14
118 0.13
119 0.12
120 0.09
121 0.09
122 0.1
123 0.1
124 0.1
125 0.13
126 0.12
127 0.12
128 0.13
129 0.14
130 0.15
131 0.18
132 0.21
133 0.19
134 0.2
135 0.2
136 0.19
137 0.18
138 0.16
139 0.13
140 0.11
141 0.14
142 0.15
143 0.15
144 0.16
145 0.17
146 0.2
147 0.2
148 0.2
149 0.16
150 0.17
151 0.16
152 0.18
153 0.19
154 0.16
155 0.16
156 0.19
157 0.18
158 0.17
159 0.17
160 0.15
161 0.13
162 0.14