Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2UUW1

Protein Details
Accession Q2UUW1    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-32VRSLISKIRRKHPKLLLRLNSHHHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045115  BOL2  
IPR002634  BolA  
IPR036065  BolA-like_sf  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0097428  P:protein maturation by iron-sulfur cluster transfer  
Pfam View protein in Pfam  
PF01722  BolA  
Amino Acid Sequences MTLLGNSGVRSLISKIRRKHPKLLLRLNSHHHPLVESSAIFLPPGLRIQSPLHPIKTFPAHLMYSRTSTLLSRSCRYFFRAPVHQRQTFSISARSFAAVNAAMADATAGVTPEGLKSKLIEQLQAQHVEIEDLSGGCGQAFQAVIVSPQFEKKTMLARHRLVNSVLKAEIAAIHAWTPKCYTPEQWQALQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.52
4 0.63
5 0.68
6 0.75
7 0.77
8 0.78
9 0.81
10 0.84
11 0.83
12 0.81
13 0.81
14 0.78
15 0.73
16 0.68
17 0.59
18 0.49
19 0.41
20 0.34
21 0.31
22 0.26
23 0.2
24 0.18
25 0.17
26 0.16
27 0.15
28 0.13
29 0.1
30 0.09
31 0.12
32 0.11
33 0.1
34 0.13
35 0.16
36 0.21
37 0.27
38 0.31
39 0.32
40 0.3
41 0.31
42 0.32
43 0.34
44 0.3
45 0.25
46 0.24
47 0.22
48 0.23
49 0.27
50 0.24
51 0.22
52 0.21
53 0.2
54 0.17
55 0.16
56 0.18
57 0.2
58 0.22
59 0.23
60 0.25
61 0.26
62 0.27
63 0.33
64 0.33
65 0.31
66 0.34
67 0.41
68 0.44
69 0.52
70 0.58
71 0.55
72 0.53
73 0.5
74 0.48
75 0.4
76 0.36
77 0.32
78 0.24
79 0.22
80 0.22
81 0.2
82 0.16
83 0.13
84 0.13
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.02
97 0.03
98 0.03
99 0.04
100 0.06
101 0.06
102 0.07
103 0.07
104 0.09
105 0.15
106 0.15
107 0.16
108 0.16
109 0.22
110 0.25
111 0.26
112 0.24
113 0.19
114 0.18
115 0.17
116 0.16
117 0.1
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.04
129 0.05
130 0.05
131 0.06
132 0.06
133 0.08
134 0.07
135 0.12
136 0.13
137 0.14
138 0.16
139 0.17
140 0.26
141 0.32
142 0.39
143 0.43
144 0.46
145 0.52
146 0.53
147 0.54
148 0.48
149 0.48
150 0.43
151 0.38
152 0.34
153 0.26
154 0.24
155 0.21
156 0.19
157 0.13
158 0.11
159 0.09
160 0.11
161 0.15
162 0.16
163 0.17
164 0.2
165 0.22
166 0.24
167 0.27
168 0.3
169 0.35
170 0.45
171 0.49