Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EPG1

Protein Details
Accession A0A178EPG1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTTSKGRKRSRRRTGGYTEKGEIHydrophilic
NLS Segment(s)
PositionSequence
5-13KGRKRSRRR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007853  Znf_DNL-typ  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05180  zf-DNL  
Amino Acid Sequences MTTSKGRKRSRRRTGGYTEKGEILSPWPLDRDYFDTRLRQRADFPSRNSYSTTTRDPHPLTDNKTSATTEEEAQAAQARRDQEPAYLIYFTCKPCSHSNRHVISDHLKIFSDAPVTLEDLLAQKGLKITKGTMEGDMEWWAKDEENAEASPETISSEQAQLKGGEGQDGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.86
4 0.8
5 0.71
6 0.62
7 0.55
8 0.46
9 0.36
10 0.28
11 0.24
12 0.19
13 0.17
14 0.17
15 0.17
16 0.17
17 0.2
18 0.23
19 0.25
20 0.28
21 0.31
22 0.37
23 0.4
24 0.47
25 0.47
26 0.42
27 0.42
28 0.47
29 0.54
30 0.53
31 0.54
32 0.56
33 0.55
34 0.55
35 0.52
36 0.45
37 0.4
38 0.38
39 0.39
40 0.32
41 0.31
42 0.37
43 0.36
44 0.35
45 0.37
46 0.37
47 0.38
48 0.42
49 0.41
50 0.35
51 0.35
52 0.32
53 0.27
54 0.25
55 0.2
56 0.14
57 0.14
58 0.13
59 0.11
60 0.11
61 0.14
62 0.11
63 0.1
64 0.12
65 0.13
66 0.13
67 0.16
68 0.16
69 0.13
70 0.14
71 0.15
72 0.13
73 0.12
74 0.11
75 0.11
76 0.14
77 0.13
78 0.15
79 0.14
80 0.17
81 0.25
82 0.31
83 0.37
84 0.42
85 0.5
86 0.51
87 0.54
88 0.51
89 0.46
90 0.44
91 0.42
92 0.36
93 0.27
94 0.23
95 0.21
96 0.21
97 0.19
98 0.16
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.08
107 0.09
108 0.08
109 0.07
110 0.07
111 0.09
112 0.1
113 0.12
114 0.12
115 0.12
116 0.15
117 0.19
118 0.2
119 0.19
120 0.2
121 0.19
122 0.19
123 0.21
124 0.18
125 0.14
126 0.14
127 0.14
128 0.12
129 0.12
130 0.12
131 0.11
132 0.13
133 0.13
134 0.14
135 0.13
136 0.14
137 0.13
138 0.12
139 0.12
140 0.1
141 0.12
142 0.11
143 0.17
144 0.18
145 0.19
146 0.21
147 0.19
148 0.2
149 0.22
150 0.21
151 0.22