Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EXM9

Protein Details
Accession A0A178EXM9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
185-214LSKGKRVSLILTKKKRKRRATPDEAQRVLAHydrophilic
NLS Segment(s)
PositionSequence
196-204TKKKRKRRA
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019815  Translation_initiation_fac_3_C  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF00707  IF3_C  
PF05198  IF3_N  
Amino Acid Sequences MACLRPLFSAAQALRRTFISSIESQTAAQVSRQRHALPTRQLRYYRATPISQFSQRPHYPPPPATSAASAASRSSLPKDEEIRSAIVRVVQENGQLGEPMSLKSALASFDRSRNFLVQVRAGSEDQAPVCKIVDKSDYSASLKAKARGKESKPKSTAVQIKQIELNWAIDPHDLQHRLDQLETFLSKGKRVSLILTKKKRKRRATPDEAQRVLAAIENKLFEIGVTEVKPRRGKIMEHMEYVLDKKKAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.26
5 0.26
6 0.24
7 0.22
8 0.26
9 0.27
10 0.27
11 0.24
12 0.25
13 0.24
14 0.19
15 0.2
16 0.21
17 0.22
18 0.24
19 0.27
20 0.27
21 0.32
22 0.38
23 0.43
24 0.48
25 0.56
26 0.57
27 0.61
28 0.63
29 0.59
30 0.61
31 0.57
32 0.55
33 0.5
34 0.47
35 0.42
36 0.45
37 0.48
38 0.46
39 0.45
40 0.39
41 0.44
42 0.44
43 0.45
44 0.47
45 0.48
46 0.49
47 0.49
48 0.51
49 0.46
50 0.46
51 0.43
52 0.38
53 0.32
54 0.28
55 0.25
56 0.21
57 0.15
58 0.14
59 0.14
60 0.13
61 0.14
62 0.16
63 0.16
64 0.2
65 0.25
66 0.26
67 0.27
68 0.28
69 0.28
70 0.24
71 0.23
72 0.19
73 0.16
74 0.15
75 0.13
76 0.13
77 0.11
78 0.12
79 0.12
80 0.12
81 0.1
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.08
92 0.07
93 0.08
94 0.11
95 0.12
96 0.17
97 0.18
98 0.2
99 0.2
100 0.2
101 0.22
102 0.22
103 0.22
104 0.19
105 0.19
106 0.18
107 0.19
108 0.18
109 0.17
110 0.13
111 0.13
112 0.1
113 0.11
114 0.1
115 0.08
116 0.08
117 0.1
118 0.1
119 0.1
120 0.13
121 0.14
122 0.16
123 0.17
124 0.19
125 0.18
126 0.21
127 0.2
128 0.23
129 0.25
130 0.28
131 0.32
132 0.33
133 0.38
134 0.43
135 0.48
136 0.52
137 0.57
138 0.61
139 0.58
140 0.58
141 0.53
142 0.53
143 0.56
144 0.49
145 0.52
146 0.43
147 0.42
148 0.42
149 0.4
150 0.34
151 0.26
152 0.24
153 0.15
154 0.14
155 0.14
156 0.12
157 0.12
158 0.11
159 0.17
160 0.16
161 0.17
162 0.19
163 0.22
164 0.23
165 0.23
166 0.22
167 0.16
168 0.18
169 0.17
170 0.15
171 0.17
172 0.16
173 0.18
174 0.19
175 0.2
176 0.2
177 0.2
178 0.24
179 0.29
180 0.38
181 0.47
182 0.57
183 0.65
184 0.71
185 0.81
186 0.86
187 0.87
188 0.88
189 0.89
190 0.89
191 0.89
192 0.9
193 0.91
194 0.9
195 0.81
196 0.71
197 0.6
198 0.49
199 0.39
200 0.32
201 0.23
202 0.14
203 0.15
204 0.14
205 0.14
206 0.14
207 0.13
208 0.1
209 0.11
210 0.11
211 0.13
212 0.13
213 0.2
214 0.23
215 0.31
216 0.36
217 0.34
218 0.41
219 0.41
220 0.43
221 0.47
222 0.54
223 0.52
224 0.51
225 0.5
226 0.44
227 0.42
228 0.42
229 0.39
230 0.29