Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EU50

Protein Details
Accession A0A178EU50   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
150-185SQNGTRKRGLPRRSQRIAKKQRQKKVGAKRVEKAPAHydrophilic
NLS Segment(s)
PositionSequence
143-199KKLRKSPSQNGTRKRGLPRRSQRIAKKQRQKKVGAKRVEKAPATATNRIKKRQQRGK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MLTQRPLTPPYTAPRDPELTQYNLPQKNDTLLAELSGRCNTSLQNTLSKTTFQRLAEEVVSKNISSGPTKDTRDLEPRIHFTVSQTAQKLSQQATTTVNGIYFELTKLLPPRLQPFLLNFIGKEASEEDRYTFIINVLPWILKKLRKSPSQNGTRKRGLPRRSQRIAKKQRQKKVGAKRVEKAPATATNRIKKRQQRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.44
4 0.47
5 0.44
6 0.4
7 0.41
8 0.44
9 0.47
10 0.47
11 0.48
12 0.43
13 0.39
14 0.37
15 0.37
16 0.31
17 0.25
18 0.2
19 0.19
20 0.19
21 0.19
22 0.18
23 0.17
24 0.17
25 0.14
26 0.14
27 0.14
28 0.16
29 0.22
30 0.22
31 0.27
32 0.28
33 0.31
34 0.31
35 0.33
36 0.3
37 0.29
38 0.32
39 0.26
40 0.27
41 0.25
42 0.27
43 0.26
44 0.27
45 0.23
46 0.21
47 0.21
48 0.18
49 0.16
50 0.15
51 0.15
52 0.14
53 0.15
54 0.16
55 0.21
56 0.24
57 0.27
58 0.28
59 0.3
60 0.35
61 0.37
62 0.38
63 0.35
64 0.37
65 0.36
66 0.34
67 0.3
68 0.25
69 0.29
70 0.26
71 0.26
72 0.23
73 0.21
74 0.22
75 0.23
76 0.24
77 0.17
78 0.18
79 0.15
80 0.16
81 0.17
82 0.17
83 0.17
84 0.14
85 0.14
86 0.1
87 0.1
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.08
95 0.1
96 0.11
97 0.12
98 0.16
99 0.18
100 0.19
101 0.19
102 0.19
103 0.23
104 0.24
105 0.22
106 0.18
107 0.17
108 0.17
109 0.15
110 0.14
111 0.1
112 0.11
113 0.13
114 0.13
115 0.13
116 0.14
117 0.14
118 0.14
119 0.12
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.09
127 0.13
128 0.16
129 0.18
130 0.23
131 0.31
132 0.38
133 0.46
134 0.55
135 0.61
136 0.67
137 0.74
138 0.78
139 0.78
140 0.78
141 0.76
142 0.74
143 0.75
144 0.74
145 0.7
146 0.73
147 0.75
148 0.78
149 0.8
150 0.83
151 0.83
152 0.85
153 0.89
154 0.88
155 0.88
156 0.88
157 0.88
158 0.88
159 0.87
160 0.86
161 0.86
162 0.85
163 0.85
164 0.83
165 0.81
166 0.8
167 0.79
168 0.7
169 0.61
170 0.57
171 0.56
172 0.55
173 0.56
174 0.56
175 0.58
176 0.64
177 0.68
178 0.72
179 0.73