FuNGI

A0A178EYK2

Protein Details

Accession

A0A178EYK2

Localization Confidence

Medium

Confidence Score

12.8

NoLS Segment(s)

Position	Sequence	Protein Nature
92-117	KPFPPGEKKRAVKKGSRRPTQSARAG	Basic

NLS Segment(s)

Position	Sequence
96-110	PGEKKRAVKKGSRRP

Subcellular Location(s)

nucl 15, extr 8, mito_nucl 8

Family & Domain DBs

InterPro	View protein in InterPro IPR018608 Gti1/Pac2
Pfam	View protein in Pfam PF09729 Gti1_Pac2

Amino Acid Sequences

MGNGSAAVLEPTYTGYVASTHDALILFEACLTGVLHHVPRRPHDRERAQLVRSGSVFIYEENASGIKRWTDGVTWSPSRILGNFLVYRELDKPFPPGEKKRAVKKGSRRPTQSARAGEPYPRLQDNGTPVNGSVGSVASVTGSAYSPGAPSPVAAGAGPGGAVAGNGTGFAPERGQQSELERALVGSLVDSYGFKDSGLVKKTMSVTVSGVTHHLVSYYSVDDVMRGVLSPPSMVESLRYIRPRQELTTKQSFRAPIEDPDQPSLDDGDPSQSLYAYRPNPATAAAMVPQYGMPQSAGYYAMPQPYSSHHHQQQQHQHPHHHQQQQHPSQQQQQQQQHHPQQSAHHQHPHHQPPPPPPHQQHPSQQPPPPSVPGYGVAPPQQNPYLQQSPAAATSDLPPKSEEYASYRGPSAAAAYQNAAAAAAAAAYPPSSAAASAAPHIYRTPSIPTRPGPSDMPPTSLDPAGSPSAATTYSRASFSLPGSIDSKPGQPQTSPPQQQAPNPQQQQSQQQPQQQQQPLDRSPYASSSARRESGYYDQAQAQAQAQAQAAHQRRASIQAPPQQQQPPQPPQQPSQPYYSGTAATGQTSYQGPPPMSTWGATHGQAI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.08
3	0.09
4	0.11
5	0.14
6	0.13
7	0.12
8	0.14
9	0.14
10	0.14
11	0.14
12	0.13
13	0.1
14	0.09
15	0.09
16	0.07
17	0.08
18	0.08
19	0.07
20	0.08
21	0.11
22	0.17
23	0.22
24	0.27
25	0.31
26	0.39
27	0.48
28	0.53
29	0.59
30	0.64
31	0.7
32	0.73
33	0.78
34	0.78
35	0.7
36	0.68
37	0.61
38	0.55
39	0.46
40	0.4
41	0.3
42	0.24
43	0.23
44	0.18
45	0.19
46	0.15
47	0.14
48	0.13
49	0.14
50	0.12
51	0.13
52	0.15
53	0.12
54	0.13
55	0.14
56	0.15
57	0.16
58	0.19
59	0.23
60	0.29
61	0.3
62	0.3
63	0.29
64	0.29
65	0.29
66	0.26
67	0.25
68	0.19
69	0.23
70	0.24
71	0.24
72	0.25
73	0.23
74	0.26
75	0.24
76	0.25
77	0.21
78	0.2
79	0.24
80	0.24
81	0.31
82	0.37
83	0.43
84	0.48
85	0.56
86	0.62
87	0.68
88	0.75
89	0.75
90	0.76
91	0.79
92	0.81
93	0.82
94	0.84
95	0.81
96	0.8
97	0.82
98	0.82
99	0.8
100	0.74
101	0.68
102	0.64
103	0.59
104	0.55
105	0.5
106	0.45
107	0.42
108	0.37
109	0.34
110	0.29
111	0.31
112	0.33
113	0.33
114	0.29
115	0.25
116	0.24
117	0.25
118	0.23
119	0.2
120	0.14
121	0.08
122	0.08
123	0.07
124	0.07
125	0.05
126	0.05
127	0.05
128	0.05
129	0.05
130	0.05
131	0.06
132	0.06
133	0.07
134	0.07
135	0.08
136	0.07
137	0.06
138	0.07
139	0.08
140	0.08
141	0.07
142	0.07
143	0.06
144	0.06
145	0.06
146	0.04
147	0.04
148	0.03
149	0.03
150	0.03
151	0.03
152	0.03
153	0.03
154	0.03
155	0.04
156	0.04
157	0.05
158	0.06
159	0.09
160	0.11
161	0.13
162	0.14
163	0.15
164	0.18
165	0.25
166	0.24
167	0.22
168	0.2
169	0.18
170	0.17
171	0.16
172	0.12
173	0.05
174	0.05
175	0.04
176	0.05
177	0.05
178	0.06
179	0.07
180	0.07
181	0.07
182	0.09
183	0.12
184	0.18
185	0.21
186	0.21
187	0.19
188	0.23
189	0.25
190	0.25
191	0.22
192	0.17
193	0.15
194	0.16
195	0.16
196	0.13
197	0.12
198	0.11
199	0.1
200	0.09
201	0.08
202	0.07
203	0.07
204	0.08
205	0.08
206	0.08
207	0.08
208	0.08
209	0.08
210	0.07
211	0.07
212	0.05
213	0.05
214	0.05
215	0.06
216	0.06
217	0.06
218	0.05
219	0.07
220	0.08
221	0.07
222	0.08
223	0.1
224	0.13
225	0.18
226	0.21
227	0.2
228	0.24
229	0.28
230	0.3
231	0.31
232	0.36
233	0.38
234	0.42
235	0.52
236	0.49
237	0.46
238	0.47
239	0.45
240	0.38
241	0.36
242	0.31
243	0.23
244	0.26
245	0.28
246	0.26
247	0.26
248	0.25
249	0.21
250	0.19
251	0.18
252	0.14
253	0.11
254	0.09
255	0.09
256	0.09
257	0.09
258	0.09
259	0.07
260	0.07
261	0.08
262	0.14
263	0.13
264	0.15
265	0.16
266	0.16
267	0.16
268	0.16
269	0.16
270	0.1
271	0.1
272	0.08
273	0.08
274	0.08
275	0.07
276	0.07
277	0.06
278	0.06
279	0.05
280	0.05
281	0.04
282	0.05
283	0.05
284	0.06
285	0.06
286	0.08
287	0.09
288	0.1
289	0.1
290	0.1
291	0.1
292	0.12
293	0.18
294	0.2
295	0.26
296	0.3
297	0.37
298	0.41
299	0.49
300	0.56
301	0.61
302	0.66
303	0.62
304	0.62
305	0.6
306	0.65
307	0.66
308	0.62
309	0.56
310	0.56
311	0.63
312	0.65
313	0.66
314	0.6
315	0.54
316	0.55
317	0.57
318	0.55
319	0.54
320	0.54
321	0.54
322	0.58
323	0.64
324	0.64
325	0.62
326	0.57
327	0.49
328	0.46
329	0.49
330	0.49
331	0.44
332	0.44
333	0.4
334	0.46
335	0.54
336	0.59
337	0.54
338	0.52
339	0.53
340	0.55
341	0.64
342	0.63
343	0.61
344	0.55
345	0.59
346	0.59
347	0.6
348	0.58
349	0.58
350	0.62
351	0.59
352	0.6
353	0.55
354	0.54
355	0.51
356	0.46
357	0.38
358	0.3
359	0.25
360	0.23
361	0.21
362	0.19
363	0.18
364	0.18
365	0.18
366	0.18
367	0.2
368	0.2
369	0.18
370	0.19
371	0.25
372	0.25
373	0.24
374	0.24
375	0.22
376	0.22
377	0.22
378	0.21
379	0.14
380	0.11
381	0.14
382	0.2
383	0.19
384	0.18
385	0.18
386	0.18
387	0.21
388	0.21
389	0.19
390	0.18
391	0.23
392	0.24
393	0.24
394	0.23
395	0.21
396	0.2
397	0.18
398	0.15
399	0.13
400	0.12
401	0.12
402	0.12
403	0.12
404	0.12
405	0.12
406	0.1
407	0.06
408	0.05
409	0.04
410	0.04
411	0.03
412	0.03
413	0.03
414	0.03
415	0.03
416	0.03
417	0.04
418	0.04
419	0.04
420	0.05
421	0.06
422	0.07
423	0.08
424	0.1
425	0.09
426	0.1
427	0.11
428	0.12
429	0.12
430	0.13
431	0.19
432	0.23
433	0.27
434	0.31
435	0.34
436	0.38
437	0.4
438	0.42
439	0.37
440	0.36
441	0.42
442	0.37
443	0.38
444	0.33
445	0.33
446	0.32
447	0.3
448	0.25
449	0.17
450	0.19
451	0.17
452	0.15
453	0.12
454	0.1
455	0.11
456	0.11
457	0.12
458	0.1
459	0.12
460	0.14
461	0.15
462	0.15
463	0.16
464	0.18
465	0.18
466	0.23
467	0.19
468	0.2
469	0.21
470	0.21
471	0.22
472	0.21
473	0.24
474	0.23
475	0.26
476	0.26
477	0.24
478	0.3
479	0.36
480	0.46
481	0.46
482	0.45
483	0.49
484	0.51
485	0.55
486	0.6
487	0.6
488	0.59
489	0.59
490	0.6
491	0.56
492	0.58
493	0.62
494	0.6
495	0.62
496	0.58
497	0.61
498	0.66
499	0.67
500	0.72
501	0.69
502	0.65
503	0.62
504	0.63
505	0.59
506	0.58
507	0.53
508	0.46
509	0.42
510	0.38
511	0.37
512	0.33
513	0.34
514	0.35
515	0.4
516	0.4
517	0.39
518	0.37
519	0.37
520	0.4
521	0.43
522	0.38
523	0.35
524	0.34
525	0.36
526	0.35
527	0.31
528	0.25
529	0.22
530	0.21
531	0.2
532	0.19
533	0.17
534	0.18
535	0.26
536	0.29
537	0.31
538	0.31
539	0.3
540	0.31
541	0.36
542	0.37
543	0.35
544	0.39
545	0.42
546	0.49
547	0.5
548	0.56
549	0.55
550	0.58
551	0.59
552	0.61
553	0.62
554	0.64
555	0.69
556	0.67
557	0.66
558	0.71
559	0.71
560	0.64
561	0.62
562	0.56
563	0.51
564	0.5
565	0.47
566	0.38
567	0.29
568	0.3
569	0.24
570	0.22
571	0.2
572	0.16
573	0.16
574	0.17
575	0.17
576	0.18
577	0.22
578	0.22
579	0.23
580	0.25
581	0.28
582	0.28
583	0.27
584	0.24
585	0.24
586	0.27

A0A178EYK2

3D AlphaFold-predicted Structure Viewer