Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EZP8

Protein Details
Accession A0A178EZP8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
50-72LYAERLKRASRNREKARENRARIHydrophilic
NLS Segment(s)
PositionSequence
56-69KRASRNREKARENR
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MTASTSASTLADHLDCEEVMTMLDECHAKGFMHKVFGNCNDIKREVNRCLYAERLKRASRNREKARENRARIEKLWDEDAAQGQMKSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.07
6 0.07
7 0.08
8 0.07
9 0.06
10 0.08
11 0.07
12 0.07
13 0.08
14 0.09
15 0.08
16 0.09
17 0.14
18 0.14
19 0.19
20 0.21
21 0.21
22 0.24
23 0.26
24 0.3
25 0.26
26 0.27
27 0.25
28 0.25
29 0.25
30 0.26
31 0.28
32 0.27
33 0.3
34 0.29
35 0.28
36 0.27
37 0.3
38 0.34
39 0.33
40 0.34
41 0.36
42 0.37
43 0.43
44 0.51
45 0.57
46 0.6
47 0.66
48 0.71
49 0.75
50 0.81
51 0.82
52 0.85
53 0.84
54 0.79
55 0.78
56 0.77
57 0.72
58 0.65
59 0.64
60 0.59
61 0.52
62 0.5
63 0.4
64 0.33
65 0.31
66 0.32
67 0.26
68 0.23
69 0.19