Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EP15

Protein Details
Accession A0A178EP15   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
216-242KLPKRNFEKSTKRKRTTKRINVDKTTFHydrophilic
NLS Segment(s)
PositionSequence
219-233KRNFEKSTKRKRTTK
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002109  Glutaredoxin  
IPR014025  Glutaredoxin_subgr  
IPR000702  Ribosomal_L6  
IPR020040  Ribosomal_L6_a/b-dom  
IPR036789  Ribosomal_L6_a/b-dom_sf  
IPR002359  Ribosomal_L6_CS2  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0016491  F:oxidoreductase activity  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PF00347  Ribosomal_L6  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
PS00700  RIBOSOMAL_L6_2  
CDD cd03419  GRX_GRXh_1_2_like  
Amino Acid Sequences MFSPRRLRLYLISAVILGDVRRTQALRAAGTSQLGKSNPNLKGSSRDHGNDKDNDGGVFDKLKPGALRPGDKQKTVKVEEPEQTPTSAKKGKGDGKDEEEATDDTKSEDEIVNEEMNTILKRSPIIIFSKSYCPYSKKAKYFMLEKYNITPAPFVVELDEHPLGRQLQDLLGTNTGRRTVPNILVNGKTIGGGDDIESLYLSGDLGTKLQALATAKLPKRNFEKSTKRKRTTKRINVDKTTFNSPVSPSVSFFTGGVKMLYIHSQETLQIPENVNLHIRSRIVTVEGPRGKLVKDLSHLSVCFSRPKKDTIAIEVHHGGRKAVATLRTVRTIINNLIIGVTRGFKYKMRYVYAHFPINVNIETNKETGAVELEIRNFLGEKVVRRVVCQKGVDVVASSNVKDEIVLSGNSIEGVSQSAADIQQICRVRNKDIRKFLDGIYVSEKGNIVEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.22
4 0.15
5 0.12
6 0.11
7 0.12
8 0.15
9 0.15
10 0.16
11 0.21
12 0.25
13 0.24
14 0.26
15 0.27
16 0.26
17 0.28
18 0.29
19 0.24
20 0.25
21 0.23
22 0.23
23 0.27
24 0.34
25 0.35
26 0.38
27 0.39
28 0.36
29 0.45
30 0.48
31 0.5
32 0.48
33 0.48
34 0.49
35 0.53
36 0.58
37 0.53
38 0.52
39 0.49
40 0.43
41 0.39
42 0.34
43 0.28
44 0.23
45 0.21
46 0.18
47 0.18
48 0.17
49 0.2
50 0.2
51 0.21
52 0.29
53 0.32
54 0.37
55 0.39
56 0.5
57 0.52
58 0.56
59 0.57
60 0.55
61 0.58
62 0.57
63 0.58
64 0.52
65 0.55
66 0.54
67 0.55
68 0.54
69 0.46
70 0.43
71 0.38
72 0.34
73 0.34
74 0.35
75 0.33
76 0.32
77 0.39
78 0.45
79 0.51
80 0.55
81 0.53
82 0.54
83 0.56
84 0.51
85 0.43
86 0.38
87 0.31
88 0.27
89 0.21
90 0.15
91 0.11
92 0.11
93 0.11
94 0.1
95 0.1
96 0.09
97 0.11
98 0.13
99 0.13
100 0.13
101 0.13
102 0.11
103 0.11
104 0.11
105 0.1
106 0.09
107 0.09
108 0.09
109 0.11
110 0.12
111 0.15
112 0.19
113 0.2
114 0.22
115 0.25
116 0.31
117 0.31
118 0.32
119 0.32
120 0.32
121 0.35
122 0.43
123 0.49
124 0.48
125 0.52
126 0.55
127 0.56
128 0.58
129 0.6
130 0.59
131 0.53
132 0.49
133 0.45
134 0.44
135 0.4
136 0.35
137 0.28
138 0.18
139 0.19
140 0.17
141 0.14
142 0.1
143 0.1
144 0.1
145 0.14
146 0.15
147 0.11
148 0.11
149 0.14
150 0.13
151 0.12
152 0.13
153 0.09
154 0.09
155 0.1
156 0.12
157 0.11
158 0.13
159 0.14
160 0.13
161 0.13
162 0.15
163 0.13
164 0.12
165 0.14
166 0.16
167 0.2
168 0.23
169 0.25
170 0.26
171 0.26
172 0.27
173 0.24
174 0.2
175 0.15
176 0.11
177 0.09
178 0.07
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.05
186 0.05
187 0.05
188 0.04
189 0.03
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.05
196 0.05
197 0.06
198 0.07
199 0.08
200 0.11
201 0.19
202 0.2
203 0.27
204 0.27
205 0.3
206 0.35
207 0.41
208 0.42
209 0.44
210 0.54
211 0.59
212 0.7
213 0.76
214 0.78
215 0.8
216 0.84
217 0.86
218 0.86
219 0.86
220 0.84
221 0.84
222 0.85
223 0.82
224 0.76
225 0.7
226 0.61
227 0.56
228 0.47
229 0.37
230 0.3
231 0.25
232 0.25
233 0.23
234 0.2
235 0.15
236 0.15
237 0.16
238 0.15
239 0.14
240 0.11
241 0.1
242 0.1
243 0.09
244 0.08
245 0.07
246 0.08
247 0.09
248 0.09
249 0.08
250 0.09
251 0.09
252 0.1
253 0.1
254 0.12
255 0.12
256 0.14
257 0.14
258 0.16
259 0.17
260 0.17
261 0.17
262 0.16
263 0.16
264 0.15
265 0.14
266 0.12
267 0.13
268 0.13
269 0.13
270 0.15
271 0.16
272 0.23
273 0.25
274 0.25
275 0.25
276 0.26
277 0.24
278 0.25
279 0.24
280 0.18
281 0.2
282 0.22
283 0.24
284 0.26
285 0.25
286 0.24
287 0.25
288 0.23
289 0.28
290 0.27
291 0.31
292 0.3
293 0.34
294 0.36
295 0.38
296 0.39
297 0.37
298 0.41
299 0.35
300 0.37
301 0.37
302 0.35
303 0.31
304 0.29
305 0.23
306 0.18
307 0.18
308 0.16
309 0.16
310 0.17
311 0.18
312 0.24
313 0.26
314 0.28
315 0.28
316 0.27
317 0.26
318 0.27
319 0.25
320 0.22
321 0.2
322 0.17
323 0.17
324 0.17
325 0.14
326 0.12
327 0.12
328 0.09
329 0.11
330 0.13
331 0.15
332 0.21
333 0.27
334 0.33
335 0.37
336 0.39
337 0.43
338 0.5
339 0.53
340 0.52
341 0.46
342 0.4
343 0.38
344 0.38
345 0.33
346 0.25
347 0.2
348 0.18
349 0.2
350 0.19
351 0.17
352 0.14
353 0.14
354 0.12
355 0.13
356 0.11
357 0.11
358 0.13
359 0.14
360 0.14
361 0.14
362 0.13
363 0.12
364 0.11
365 0.15
366 0.16
367 0.19
368 0.25
369 0.31
370 0.31
371 0.34
372 0.42
373 0.42
374 0.47
375 0.44
376 0.39
377 0.38
378 0.39
379 0.36
380 0.29
381 0.23
382 0.21
383 0.21
384 0.19
385 0.16
386 0.16
387 0.15
388 0.14
389 0.14
390 0.11
391 0.12
392 0.12
393 0.12
394 0.12
395 0.12
396 0.12
397 0.11
398 0.08
399 0.06
400 0.08
401 0.07
402 0.07
403 0.07
404 0.08
405 0.09
406 0.11
407 0.13
408 0.12
409 0.19
410 0.23
411 0.25
412 0.32
413 0.34
414 0.41
415 0.48
416 0.58
417 0.61
418 0.67
419 0.72
420 0.7
421 0.7
422 0.63
423 0.63
424 0.54
425 0.47
426 0.42
427 0.38
428 0.32
429 0.31
430 0.31
431 0.21