Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178F8P9

Protein Details
Accession A0A178F8P9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-41AGGIRKGVRKRAKPMPKALKDKLRDBasic
NLS Segment(s)
PositionSequence
8-38QRQSRAKKGAGGIRKGVRKRAKPMPKALKDK
Subcellular Location(s) nucl 11, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR018744  DUF2293  
Pfam View protein in Pfam  
PF10056  DUF2293  
Amino Acid Sequences MGKPQRQQRQSRAKKGAGGIRKGVRKRAKPMPKALKDKLRDISYSKTAHGFVPEDILLDNQPRPPGYVFVPKGNVYITRKCRSQTHDLGSPVYTVYCSTTYKQTGLYVPASVQAAVELESKETSEDRKRAVAQKDARDRQKARELLLKEFPNMPRSDLTAVLNHAFLKGSRRVGRSGKVASEKDKVRLAVEAHIRHVHTEYDDMIRRGLTRERARENIWDEVVILRDSWRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.74
4 0.71
5 0.66
6 0.63
7 0.61
8 0.66
9 0.64
10 0.66
11 0.67
12 0.66
13 0.69
14 0.72
15 0.75
16 0.75
17 0.82
18 0.83
19 0.83
20 0.85
21 0.85
22 0.83
23 0.77
24 0.76
25 0.73
26 0.65
27 0.58
28 0.53
29 0.51
30 0.49
31 0.46
32 0.4
33 0.35
34 0.32
35 0.3
36 0.3
37 0.25
38 0.18
39 0.19
40 0.17
41 0.15
42 0.14
43 0.14
44 0.12
45 0.12
46 0.14
47 0.12
48 0.14
49 0.14
50 0.16
51 0.16
52 0.17
53 0.19
54 0.27
55 0.27
56 0.29
57 0.32
58 0.3
59 0.3
60 0.28
61 0.3
62 0.26
63 0.32
64 0.36
65 0.38
66 0.39
67 0.41
68 0.46
69 0.46
70 0.5
71 0.5
72 0.48
73 0.49
74 0.48
75 0.47
76 0.42
77 0.36
78 0.27
79 0.19
80 0.13
81 0.07
82 0.08
83 0.08
84 0.1
85 0.11
86 0.15
87 0.16
88 0.17
89 0.17
90 0.17
91 0.17
92 0.18
93 0.17
94 0.13
95 0.12
96 0.13
97 0.12
98 0.1
99 0.09
100 0.06
101 0.05
102 0.06
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.1
111 0.14
112 0.17
113 0.18
114 0.2
115 0.24
116 0.3
117 0.34
118 0.38
119 0.39
120 0.46
121 0.55
122 0.59
123 0.61
124 0.62
125 0.6
126 0.58
127 0.6
128 0.54
129 0.47
130 0.46
131 0.44
132 0.4
133 0.45
134 0.4
135 0.33
136 0.36
137 0.35
138 0.32
139 0.31
140 0.28
141 0.21
142 0.23
143 0.23
144 0.2
145 0.2
146 0.17
147 0.18
148 0.17
149 0.17
150 0.14
151 0.13
152 0.11
153 0.11
154 0.14
155 0.16
156 0.23
157 0.28
158 0.3
159 0.35
160 0.39
161 0.44
162 0.45
163 0.44
164 0.43
165 0.45
166 0.45
167 0.45
168 0.47
169 0.46
170 0.43
171 0.44
172 0.39
173 0.32
174 0.33
175 0.3
176 0.3
177 0.35
178 0.33
179 0.33
180 0.35
181 0.35
182 0.32
183 0.32
184 0.27
185 0.21
186 0.21
187 0.19
188 0.22
189 0.26
190 0.25
191 0.24
192 0.24
193 0.23
194 0.25
195 0.29
196 0.32
197 0.37
198 0.44
199 0.51
200 0.55
201 0.57
202 0.61
203 0.59
204 0.56
205 0.48
206 0.4
207 0.34
208 0.31
209 0.3
210 0.23
211 0.18