Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EUG9

Protein Details
Accession A0A178EUG9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-46QTPKVEPQEKKKTPKGRAKKRLQYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRLQYTRRFVNVTMTGGKRKVGLFYTSRNDGFLEHDSKLTLLLQMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.51
6 0.6
7 0.62
8 0.68
9 0.68
10 0.7
11 0.73
12 0.74
13 0.77
14 0.77
15 0.78
16 0.78
17 0.81
18 0.82
19 0.82
20 0.86
21 0.88
22 0.88
23 0.89
24 0.9
25 0.88
26 0.86
27 0.82
28 0.8
29 0.74
30 0.66
31 0.55
32 0.51
33 0.44
34 0.37
35 0.34
36 0.27
37 0.25
38 0.24
39 0.24
40 0.2
41 0.18
42 0.18
43 0.16
44 0.19
45 0.19
46 0.24
47 0.29
48 0.31
49 0.31
50 0.3
51 0.28
52 0.24
53 0.25
54 0.24
55 0.23
56 0.19
57 0.2
58 0.19
59 0.19
60 0.19
61 0.16
62 0.14
63 0.13
64 0.17
65 0.23
66 0.26
67 0.3