Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EWP9

Protein Details
Accession A0A178EWP9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
175-202DVATTLSRQRKSKKRRRLSSLSAMRPASHydrophilic
NLS Segment(s)
PositionSequence
183-192QRKSKKRRRL
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022793  Rrn10  
Gene Ontology GO:0006360  P:transcription by RNA polymerase I  
Pfam View protein in Pfam  
PF05234  UAF_Rrn10  
Amino Acid Sequences MDRNIDEKSARLGHINASERRGAKYRHANVYDAVAAVAPEEVLFRKQNAPVRYMENDYYFANEDIPEDQPLPDSDLLKAIHAYTSDLYANKTVDRGQSAWRSMDETALIALGFLLEETAVEALGETGDLALVEGAVPSDPEWEAEAPVVRSRETSVSAFSTRSRIDGYSSGGLDDVATTLSRQRKSKKRRRLSSLSAMRPASEKPVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.37
4 0.37
5 0.41
6 0.4
7 0.43
8 0.44
9 0.39
10 0.42
11 0.49
12 0.53
13 0.58
14 0.59
15 0.57
16 0.51
17 0.52
18 0.43
19 0.33
20 0.25
21 0.15
22 0.12
23 0.1
24 0.09
25 0.05
26 0.04
27 0.05
28 0.06
29 0.09
30 0.1
31 0.12
32 0.15
33 0.21
34 0.28
35 0.29
36 0.31
37 0.31
38 0.35
39 0.36
40 0.37
41 0.34
42 0.29
43 0.29
44 0.26
45 0.25
46 0.22
47 0.19
48 0.15
49 0.13
50 0.12
51 0.11
52 0.13
53 0.11
54 0.1
55 0.1
56 0.11
57 0.11
58 0.13
59 0.13
60 0.13
61 0.12
62 0.15
63 0.15
64 0.14
65 0.14
66 0.11
67 0.1
68 0.1
69 0.11
70 0.07
71 0.09
72 0.09
73 0.1
74 0.1
75 0.11
76 0.11
77 0.1
78 0.11
79 0.11
80 0.11
81 0.12
82 0.13
83 0.16
84 0.19
85 0.2
86 0.2
87 0.19
88 0.2
89 0.18
90 0.17
91 0.13
92 0.09
93 0.07
94 0.06
95 0.06
96 0.04
97 0.03
98 0.03
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.03
125 0.04
126 0.05
127 0.05
128 0.07
129 0.07
130 0.08
131 0.09
132 0.1
133 0.1
134 0.13
135 0.14
136 0.12
137 0.13
138 0.14
139 0.16
140 0.17
141 0.17
142 0.16
143 0.19
144 0.2
145 0.21
146 0.2
147 0.23
148 0.2
149 0.2
150 0.2
151 0.17
152 0.19
153 0.2
154 0.23
155 0.22
156 0.22
157 0.21
158 0.19
159 0.18
160 0.15
161 0.12
162 0.08
163 0.05
164 0.05
165 0.06
166 0.12
167 0.19
168 0.24
169 0.31
170 0.41
171 0.51
172 0.62
173 0.73
174 0.78
175 0.83
176 0.88
177 0.91
178 0.91
179 0.89
180 0.89
181 0.89
182 0.85
183 0.81
184 0.71
185 0.62
186 0.54
187 0.46