FuNGI

A0A178F7R2

Protein Details

Accession

A0A178F7R2

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
514-534	ANPLSISRRRSRRHADEDSDL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 16, E.R. 3, golg 3, cyto 2, mito 1, cyto_nucl 1, pero 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR008402 APC_su15/mnd2
Gene Ontology	GO:0005680 C:anaphase-promoting complex GO:0031145 P:anaphase-promoting complex-dependent catabolic process GO:0030071 P:regulation of mitotic metaphase/anaphase transition
Pfam	View protein in Pfam PF05841 Apc15p

Amino Acid Sequences

MKLASAVFIGLAAFVAYAQATPVSPSETPTTGEFTRTPGTVVDTRKFQGKMSAKPSKRNTPTDDEVLTLDLSTISAPIQPEDPDHAILPSHTPAIRGRSGATIDCPPYAPWTCDGVTCFNFFTHNCCKGGVVCKDPDVCPTCSNIQAPVSYITPSSSTMFNPLPPIEPRDSHTLWYSSSYTGRSAANSSQNPTSGAQNPQPGRRNGRSQGTNTPLFSASFDPLSTLLAEERALTLRKQNIASFGFSWIRPAGFPKTMMGLREEELECEEGAGAGLGEGDIEEEEFMEGIEGGEGGLGLDGAGEGVEGDAGMERDLDGDIPDGDGEGFGLVEEGEEGYEDEEEEFLDEEEEGMMARDLDDDVPEAPDADEEDEEEDGDEDDQEDGYGDTSEVRPPNNTRTPGESHMMMERDLDGSVPDAPQETPSRQQEWEHTDSDEDVYDEDDDEVEEEEQEGEDEGTDEGHSRLSWASLPPGYIPHLTPSGPRRETEAERLFIERWGGNDDSIDIGSSDMLPANPLSISRRRSRRHADEDSDLEEM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.04
2	0.04
3	0.04
4	0.04
5	0.05
6	0.06
7	0.06
8	0.08
9	0.09
10	0.13
11	0.13
12	0.16
13	0.2
14	0.21
15	0.23
16	0.23
17	0.28
18	0.24
19	0.28
20	0.25
21	0.26
22	0.27
23	0.25
24	0.25
25	0.2
26	0.25
27	0.28
28	0.33
29	0.32
30	0.34
31	0.35
32	0.41
33	0.41
34	0.36
35	0.4
36	0.42
37	0.46
38	0.51
39	0.61
40	0.59
41	0.68
42	0.75
43	0.76
44	0.77
45	0.76
46	0.73
47	0.71
48	0.72
49	0.68
50	0.6
51	0.51
52	0.43
53	0.36
54	0.29
55	0.21
56	0.15
57	0.09
58	0.08
59	0.07
60	0.06
61	0.05
62	0.07
63	0.08
64	0.09
65	0.11
66	0.11
67	0.13
68	0.19
69	0.2
70	0.2
71	0.2
72	0.19
73	0.18
74	0.18
75	0.19
76	0.14
77	0.16
78	0.15
79	0.16
80	0.19
81	0.24
82	0.26
83	0.24
84	0.24
85	0.24
86	0.26
87	0.25
88	0.25
89	0.24
90	0.24
91	0.24
92	0.23
93	0.2
94	0.24
95	0.25
96	0.23
97	0.21
98	0.23
99	0.23
100	0.24
101	0.25
102	0.24
103	0.24
104	0.24
105	0.22
106	0.19
107	0.21
108	0.19
109	0.24
110	0.27
111	0.29
112	0.28
113	0.28
114	0.28
115	0.3
116	0.38
117	0.37
118	0.33
119	0.31
120	0.34
121	0.36
122	0.35
123	0.38
124	0.34
125	0.32
126	0.28
127	0.3
128	0.28
129	0.29
130	0.3
131	0.25
132	0.23
133	0.2
134	0.21
135	0.19
136	0.18
137	0.15
138	0.14
139	0.13
140	0.12
141	0.13
142	0.13
143	0.12
144	0.12
145	0.16
146	0.16
147	0.17
148	0.18
149	0.17
150	0.19
151	0.19
152	0.24
153	0.22
154	0.23
155	0.25
156	0.29
157	0.3
158	0.28
159	0.29
160	0.25
161	0.23
162	0.25
163	0.23
164	0.18
165	0.19
166	0.18
167	0.16
168	0.17
169	0.17
170	0.15
171	0.16
172	0.19
173	0.24
174	0.25
175	0.27
176	0.26
177	0.26
178	0.27
179	0.25
180	0.25
181	0.21
182	0.23
183	0.24
184	0.3
185	0.32
186	0.37
187	0.42
188	0.42
189	0.46
190	0.47
191	0.51
192	0.49
193	0.55
194	0.52
195	0.5
196	0.54
197	0.51
198	0.49
199	0.41
200	0.38
201	0.31
202	0.27
203	0.24
204	0.18
205	0.14
206	0.12
207	0.11
208	0.1
209	0.09
210	0.09
211	0.08
212	0.07
213	0.06
214	0.06
215	0.06
216	0.05
217	0.06
218	0.07
219	0.08
220	0.08
221	0.12
222	0.15
223	0.18
224	0.19
225	0.19
226	0.22
227	0.23
228	0.24
229	0.21
230	0.21
231	0.2
232	0.18
233	0.19
234	0.15
235	0.14
236	0.12
237	0.14
238	0.14
239	0.14
240	0.15
241	0.13
242	0.16
243	0.17
244	0.17
245	0.16
246	0.14
247	0.13
248	0.16
249	0.16
250	0.13
251	0.13
252	0.13
253	0.11
254	0.09
255	0.08
256	0.05
257	0.04
258	0.04
259	0.03
260	0.02
261	0.02
262	0.02
263	0.02
264	0.02
265	0.02
266	0.02
267	0.02
268	0.02
269	0.02
270	0.02
271	0.02
272	0.02
273	0.02
274	0.02
275	0.02
276	0.02
277	0.02
278	0.02
279	0.02
280	0.02
281	0.02
282	0.02
283	0.02
284	0.02
285	0.02
286	0.02
287	0.02
288	0.02
289	0.02
290	0.02
291	0.02
292	0.02
293	0.02
294	0.02
295	0.02
296	0.03
297	0.03
298	0.03
299	0.03
300	0.04
301	0.04
302	0.04
303	0.04
304	0.04
305	0.04
306	0.05
307	0.05
308	0.04
309	0.04
310	0.04
311	0.03
312	0.03
313	0.03
314	0.02
315	0.03
316	0.02
317	0.02
318	0.03
319	0.03
320	0.02
321	0.03
322	0.03
323	0.03
324	0.03
325	0.04
326	0.04
327	0.04
328	0.04
329	0.04
330	0.05
331	0.04
332	0.05
333	0.04
334	0.04
335	0.04
336	0.04
337	0.04
338	0.04
339	0.04
340	0.03
341	0.04
342	0.04
343	0.04
344	0.05
345	0.05
346	0.05
347	0.06
348	0.07
349	0.07
350	0.07
351	0.06
352	0.06
353	0.07
354	0.07
355	0.07
356	0.07
357	0.08
358	0.07
359	0.07
360	0.07
361	0.07
362	0.06
363	0.06
364	0.05
365	0.05
366	0.05
367	0.05
368	0.05
369	0.05
370	0.05
371	0.05
372	0.05
373	0.05
374	0.06
375	0.07
376	0.11
377	0.13
378	0.14
379	0.17
380	0.2
381	0.29
382	0.35
383	0.38
384	0.37
385	0.41
386	0.45
387	0.45
388	0.44
389	0.37
390	0.31
391	0.31
392	0.3
393	0.24
394	0.2
395	0.16
396	0.14
397	0.13
398	0.11
399	0.07
400	0.07
401	0.08
402	0.08
403	0.07
404	0.08
405	0.08
406	0.12
407	0.16
408	0.18
409	0.24
410	0.29
411	0.32
412	0.33
413	0.35
414	0.39
415	0.43
416	0.44
417	0.38
418	0.34
419	0.32
420	0.31
421	0.3
422	0.23
423	0.15
424	0.11
425	0.1
426	0.1
427	0.09
428	0.08
429	0.07
430	0.07
431	0.07
432	0.08
433	0.07
434	0.07
435	0.07
436	0.07
437	0.07
438	0.07
439	0.07
440	0.06
441	0.06
442	0.06
443	0.06
444	0.06
445	0.06
446	0.07
447	0.07
448	0.08
449	0.08
450	0.08
451	0.09
452	0.1
453	0.12
454	0.12
455	0.17
456	0.17
457	0.18
458	0.18
459	0.2
460	0.22
461	0.22
462	0.21
463	0.2
464	0.21
465	0.21
466	0.26
467	0.31
468	0.38
469	0.38
470	0.38
471	0.4
472	0.44
473	0.49
474	0.53
475	0.53
476	0.46
477	0.46
478	0.48
479	0.42
480	0.37
481	0.35
482	0.26
483	0.21
484	0.23
485	0.22
486	0.2
487	0.19
488	0.19
489	0.17
490	0.16
491	0.15
492	0.1
493	0.09
494	0.09
495	0.09
496	0.09
497	0.08
498	0.08
499	0.09
500	0.09
501	0.09
502	0.09
503	0.11
504	0.16
505	0.23
506	0.29
507	0.38
508	0.48
509	0.53
510	0.63
511	0.72
512	0.77
513	0.79
514	0.83
515	0.8
516	0.78
517	0.76

A0A178F7R2

3D AlphaFold-predicted Structure Viewer