Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178ERS5

Protein Details
Accession A0A178ERS5    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-47IKGSKVQDGRVDKKKKKKKRDKEGDVDVRKEBasic
NLS Segment(s)
PositionSequence
14-38RLKIKGSKVQDGRVDKKKKKKKRDK
91-113RRHAEAKRKRLNERLKREGVKTH
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPFSEYAVSGGGRLKIKGSKVQDGRVDKKKKKKKRDKEGDVDVRKEEEEEEQKADAAVGEASSSKEEKDRRSRSVSELLEGDDGKTEAERRHAEAKRKRLNERLKREGVKTHKERVEELNKYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.23
4 0.26
5 0.33
6 0.36
7 0.41
8 0.44
9 0.5
10 0.55
11 0.59
12 0.64
13 0.66
14 0.71
15 0.69
16 0.76
17 0.8
18 0.83
19 0.86
20 0.89
21 0.9
22 0.91
23 0.95
24 0.94
25 0.93
26 0.93
27 0.92
28 0.86
29 0.77
30 0.67
31 0.56
32 0.46
33 0.37
34 0.26
35 0.21
36 0.19
37 0.19
38 0.19
39 0.18
40 0.18
41 0.17
42 0.17
43 0.11
44 0.08
45 0.06
46 0.04
47 0.04
48 0.04
49 0.05
50 0.06
51 0.06
52 0.06
53 0.1
54 0.13
55 0.2
56 0.3
57 0.35
58 0.39
59 0.44
60 0.46
61 0.45
62 0.51
63 0.45
64 0.36
65 0.31
66 0.28
67 0.23
68 0.21
69 0.17
70 0.09
71 0.09
72 0.07
73 0.07
74 0.08
75 0.08
76 0.14
77 0.15
78 0.18
79 0.27
80 0.33
81 0.42
82 0.49
83 0.59
84 0.62
85 0.68
86 0.7
87 0.71
88 0.77
89 0.78
90 0.79
91 0.78
92 0.77
93 0.74
94 0.72
95 0.71
96 0.69
97 0.69
98 0.65
99 0.65
100 0.6
101 0.58
102 0.58
103 0.58
104 0.59
105 0.53
106 0.5
107 0.49
108 0.45
109 0.45
110 0.43
111 0.35
112 0.28
113 0.25
114 0.27
115 0.23
116 0.24
117 0.25
118 0.3
119 0.28