Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178F6U3

Protein Details
Accession A0A178F6U3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-67PSIPSSVRLRRNKRAAERAKRSEFLHydrophilic
NLS Segment(s)
PositionSequence
52-63RRNKRAAERAKR
Subcellular Location(s) mito 9, extr 7, cyto_mito 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MLRLSSLPSFLVLCTVFPGSTSVSLALRRPTADLREPTTEELPSIPSSVRLRRNKRAAERAKRSEFLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.12
6 0.1
7 0.11
8 0.11
9 0.1
10 0.11
11 0.12
12 0.13
13 0.14
14 0.14
15 0.13
16 0.15
17 0.16
18 0.18
19 0.22
20 0.23
21 0.24
22 0.26
23 0.27
24 0.28
25 0.27
26 0.23
27 0.18
28 0.16
29 0.15
30 0.12
31 0.12
32 0.1
33 0.13
34 0.17
35 0.24
36 0.33
37 0.41
38 0.49
39 0.58
40 0.68
41 0.72
42 0.78
43 0.82
44 0.83
45 0.84
46 0.87
47 0.87
48 0.85