Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UQX8

Protein Details
Accession Q2UQX8    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-62KMAPARKKWSKGKVKDKAQHABasic
NLS Segment(s)
PositionSequence
46-56ARKKWSKGKVK
Subcellular Location(s) mito 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MHGLCPRDTTCLPTRISHLGSHFRPLIVALSSVVEQPDQTVKMAPARKKWSKGKVKDKAQHAVVLEKTVAERLNKDVQSYRLITVATLVDRLKINGSLARKALEDLEEKGQIKKVVGHSKLNIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.41
4 0.37
5 0.36
6 0.39
7 0.38
8 0.41
9 0.38
10 0.32
11 0.3
12 0.27
13 0.24
14 0.16
15 0.15
16 0.1
17 0.1
18 0.1
19 0.11
20 0.1
21 0.08
22 0.07
23 0.08
24 0.1
25 0.1
26 0.1
27 0.11
28 0.12
29 0.18
30 0.24
31 0.27
32 0.32
33 0.4
34 0.45
35 0.52
36 0.6
37 0.64
38 0.68
39 0.75
40 0.78
41 0.79
42 0.83
43 0.81
44 0.78
45 0.74
46 0.65
47 0.57
48 0.47
49 0.41
50 0.31
51 0.25
52 0.19
53 0.13
54 0.12
55 0.1
56 0.11
57 0.08
58 0.09
59 0.12
60 0.19
61 0.19
62 0.21
63 0.22
64 0.22
65 0.26
66 0.26
67 0.23
68 0.18
69 0.18
70 0.16
71 0.15
72 0.14
73 0.1
74 0.11
75 0.1
76 0.11
77 0.11
78 0.12
79 0.12
80 0.11
81 0.12
82 0.14
83 0.17
84 0.18
85 0.19
86 0.2
87 0.19
88 0.19
89 0.19
90 0.18
91 0.17
92 0.17
93 0.2
94 0.24
95 0.24
96 0.25
97 0.28
98 0.27
99 0.25
100 0.28
101 0.33
102 0.38
103 0.42
104 0.46
105 0.46
106 0.53
107 0.58
108 0.56
109 0.5
110 0.43
111 0.42