Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178F3W5

Protein Details
Accession A0A178F3W5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
133-155TVIANEKKRREKEKLAEEQKREEBasic
NLS Segment(s)
PositionSequence
139-146KKRREKEK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAEGRPGTNIDSHTPTPRGGVRLNKIAESWEDEDLSSSEDEASDAETAITAPPAEASTHQHHQVSRSGIRAPPPTPNVSRQSSCRSTTSSASCTSSGYSKRPEKQIAVATRMIGNALGHRVARSDSQKEYDRTVIANEKKRREKEKLAEEQKREEEEKAKAAIWDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.32
4 0.33
5 0.33
6 0.32
7 0.38
8 0.39
9 0.45
10 0.46
11 0.43
12 0.4
13 0.38
14 0.34
15 0.31
16 0.27
17 0.21
18 0.2
19 0.19
20 0.2
21 0.18
22 0.18
23 0.12
24 0.1
25 0.08
26 0.08
27 0.08
28 0.06
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.06
35 0.05
36 0.06
37 0.04
38 0.04
39 0.04
40 0.05
41 0.06
42 0.07
43 0.12
44 0.17
45 0.2
46 0.22
47 0.24
48 0.24
49 0.26
50 0.29
51 0.29
52 0.25
53 0.25
54 0.25
55 0.24
56 0.28
57 0.29
58 0.26
59 0.26
60 0.27
61 0.29
62 0.3
63 0.33
64 0.34
65 0.34
66 0.35
67 0.33
68 0.37
69 0.37
70 0.36
71 0.33
72 0.3
73 0.29
74 0.31
75 0.3
76 0.26
77 0.23
78 0.23
79 0.22
80 0.2
81 0.18
82 0.19
83 0.18
84 0.19
85 0.25
86 0.3
87 0.34
88 0.4
89 0.42
90 0.4
91 0.43
92 0.47
93 0.44
94 0.41
95 0.38
96 0.33
97 0.3
98 0.28
99 0.22
100 0.15
101 0.11
102 0.08
103 0.09
104 0.09
105 0.09
106 0.09
107 0.1
108 0.11
109 0.16
110 0.2
111 0.22
112 0.24
113 0.3
114 0.36
115 0.37
116 0.39
117 0.37
118 0.33
119 0.3
120 0.31
121 0.34
122 0.36
123 0.44
124 0.48
125 0.55
126 0.63
127 0.7
128 0.74
129 0.74
130 0.76
131 0.77
132 0.8
133 0.81
134 0.83
135 0.84
136 0.8
137 0.8
138 0.75
139 0.7
140 0.62
141 0.55
142 0.5
143 0.45
144 0.46
145 0.4
146 0.36