Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178F4M2

Protein Details
Accession A0A178F4M2   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-88EDQPKQQQQQQQRRRHCRRQTANIRAASNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MRGRSSAPGVMLFGRCKLEAGEKREINKSRRRFRDYLTLLGLAPVAPQPRIKTNMTKFDEDQPKQQQQQQQRRRHCRRQTANIRAASNLRQARGGYRHEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.19
4 0.19
5 0.26
6 0.3
7 0.35
8 0.42
9 0.43
10 0.46
11 0.54
12 0.59
13 0.56
14 0.59
15 0.63
16 0.63
17 0.7
18 0.75
19 0.69
20 0.66
21 0.7
22 0.64
23 0.59
24 0.51
25 0.43
26 0.34
27 0.31
28 0.27
29 0.16
30 0.12
31 0.09
32 0.07
33 0.07
34 0.08
35 0.1
36 0.13
37 0.17
38 0.19
39 0.26
40 0.3
41 0.39
42 0.41
43 0.43
44 0.41
45 0.46
46 0.54
47 0.47
48 0.5
49 0.47
50 0.5
51 0.5
52 0.53
53 0.5
54 0.52
55 0.61
56 0.64
57 0.66
58 0.71
59 0.8
60 0.86
61 0.9
62 0.89
63 0.89
64 0.89
65 0.91
66 0.91
67 0.9
68 0.88
69 0.83
70 0.74
71 0.65
72 0.59
73 0.51
74 0.49
75 0.42
76 0.35
77 0.32
78 0.32
79 0.37
80 0.4