Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EY03

Protein Details
Accession A0A178EY03    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-73TVESAPVRKKRKIEPKPRITRHLDLTHydrophilic
453-482GVNTKIIKKSNQPRKPRAKKAKPADASTKTHydrophilic
NLS Segment(s)
PositionSequence
55-65RKKRKIEPKPR
447-479APPKPRGVNTKIIKKSNQPRKPRAKKAKPADAS
Subcellular Location(s) nucl 20, cyto_nucl 13.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
IPR003000  Sirtuin  
IPR026591  Sirtuin_cat_small_dom_sf  
IPR026590  Ssirtuin_cat_dom  
Gene Ontology GO:0070403  F:NAD+ binding  
GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF02146  SIR2  
PROSITE View protein in PROSITE  
PS50305  SIRTUIN  
Amino Acid Sequences MEFELSDTSSELSSLPSTPPSEDSLYPSPPESQACQAQPAAASKAAGTVESAPVRKKRKIEPKPRITRHLDLTYPDKQVCPGQEEQLKLLLRTLREHRKIVVVAGAGISVSAGIPDFRSSHGLFSTLKKDHKLKASGKQLFDASVVYQDESMISSFHDMVRTLSKLSASAKPTAFHHLLARLAHEGRLLRLYTQNVDGIEASLPPLQTKVPLEVKGPWPTTIQLHGGLHTMVCQKCSKASSFEADLFKGPDPPLCGECEKNEVIRHVGGQRSRGIGKLRPRMVLYNEYNPDEEAIGSVVSADLRARPDALVVVGTSLKIPGVRRIVKEMCRVVRGRRNGTTVWINHDPLPSGKEFEDCWDLAIKGDCDKVALHAGLKRWDDDDRSFTECTEEEFDRAKSGNTEISVVITPQKPIKFTEFTNGMPTPSSSSEDSVNPGKRSQSPTPSAPPKPRGVNTKIIKKSNQPRKPRAKKAKPADASTKTIPINKAFPSRKATAAKESKVVKEVAPCKIEDVLNPIPPESARSNGPAPLELETKKESNVVHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.18
5 0.2
6 0.22
7 0.24
8 0.27
9 0.26
10 0.32
11 0.33
12 0.34
13 0.34
14 0.33
15 0.32
16 0.3
17 0.32
18 0.29
19 0.3
20 0.34
21 0.34
22 0.36
23 0.34
24 0.33
25 0.32
26 0.32
27 0.29
28 0.23
29 0.21
30 0.17
31 0.2
32 0.19
33 0.16
34 0.14
35 0.13
36 0.17
37 0.21
38 0.24
39 0.27
40 0.35
41 0.42
42 0.47
43 0.51
44 0.57
45 0.64
46 0.72
47 0.78
48 0.81
49 0.85
50 0.9
51 0.91
52 0.9
53 0.86
54 0.82
55 0.79
56 0.74
57 0.65
58 0.58
59 0.57
60 0.53
61 0.5
62 0.44
63 0.37
64 0.32
65 0.34
66 0.32
67 0.32
68 0.28
69 0.31
70 0.35
71 0.36
72 0.35
73 0.38
74 0.36
75 0.3
76 0.32
77 0.27
78 0.25
79 0.29
80 0.37
81 0.41
82 0.45
83 0.48
84 0.45
85 0.48
86 0.47
87 0.43
88 0.37
89 0.27
90 0.22
91 0.2
92 0.17
93 0.11
94 0.1
95 0.08
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.06
103 0.07
104 0.09
105 0.14
106 0.14
107 0.16
108 0.16
109 0.18
110 0.18
111 0.22
112 0.28
113 0.29
114 0.32
115 0.35
116 0.4
117 0.44
118 0.5
119 0.55
120 0.54
121 0.58
122 0.66
123 0.66
124 0.63
125 0.59
126 0.52
127 0.44
128 0.38
129 0.29
130 0.19
131 0.16
132 0.15
133 0.12
134 0.12
135 0.1
136 0.1
137 0.1
138 0.1
139 0.06
140 0.06
141 0.07
142 0.08
143 0.09
144 0.1
145 0.09
146 0.11
147 0.14
148 0.15
149 0.14
150 0.15
151 0.14
152 0.15
153 0.18
154 0.23
155 0.22
156 0.26
157 0.26
158 0.26
159 0.28
160 0.33
161 0.3
162 0.26
163 0.25
164 0.22
165 0.24
166 0.22
167 0.22
168 0.19
169 0.18
170 0.17
171 0.17
172 0.15
173 0.14
174 0.17
175 0.15
176 0.13
177 0.17
178 0.18
179 0.17
180 0.18
181 0.19
182 0.16
183 0.16
184 0.15
185 0.12
186 0.11
187 0.09
188 0.09
189 0.08
190 0.08
191 0.08
192 0.08
193 0.07
194 0.09
195 0.1
196 0.14
197 0.17
198 0.18
199 0.2
200 0.23
201 0.28
202 0.32
203 0.32
204 0.28
205 0.25
206 0.25
207 0.25
208 0.23
209 0.2
210 0.17
211 0.16
212 0.16
213 0.15
214 0.14
215 0.12
216 0.12
217 0.16
218 0.13
219 0.15
220 0.15
221 0.14
222 0.17
223 0.19
224 0.19
225 0.17
226 0.19
227 0.2
228 0.22
229 0.26
230 0.24
231 0.23
232 0.22
233 0.2
234 0.18
235 0.17
236 0.15
237 0.12
238 0.13
239 0.14
240 0.14
241 0.15
242 0.16
243 0.15
244 0.16
245 0.18
246 0.17
247 0.17
248 0.18
249 0.16
250 0.16
251 0.16
252 0.16
253 0.15
254 0.17
255 0.16
256 0.18
257 0.18
258 0.19
259 0.19
260 0.2
261 0.2
262 0.22
263 0.29
264 0.35
265 0.35
266 0.35
267 0.36
268 0.36
269 0.37
270 0.4
271 0.34
272 0.33
273 0.33
274 0.32
275 0.31
276 0.28
277 0.25
278 0.18
279 0.14
280 0.08
281 0.06
282 0.04
283 0.04
284 0.04
285 0.03
286 0.03
287 0.03
288 0.03
289 0.05
290 0.06
291 0.06
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.06
298 0.05
299 0.06
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.07
306 0.07
307 0.12
308 0.19
309 0.23
310 0.24
311 0.31
312 0.36
313 0.39
314 0.44
315 0.45
316 0.4
317 0.41
318 0.42
319 0.43
320 0.45
321 0.48
322 0.47
323 0.45
324 0.46
325 0.42
326 0.44
327 0.43
328 0.37
329 0.36
330 0.34
331 0.31
332 0.3
333 0.3
334 0.27
335 0.21
336 0.23
337 0.16
338 0.15
339 0.14
340 0.14
341 0.14
342 0.15
343 0.18
344 0.15
345 0.16
346 0.15
347 0.15
348 0.14
349 0.16
350 0.14
351 0.12
352 0.13
353 0.12
354 0.11
355 0.11
356 0.11
357 0.12
358 0.12
359 0.12
360 0.14
361 0.17
362 0.22
363 0.23
364 0.22
365 0.21
366 0.23
367 0.25
368 0.25
369 0.26
370 0.24
371 0.27
372 0.26
373 0.24
374 0.25
375 0.21
376 0.21
377 0.21
378 0.18
379 0.17
380 0.19
381 0.2
382 0.19
383 0.2
384 0.18
385 0.15
386 0.16
387 0.16
388 0.15
389 0.16
390 0.14
391 0.15
392 0.15
393 0.14
394 0.17
395 0.15
396 0.16
397 0.2
398 0.21
399 0.21
400 0.23
401 0.29
402 0.27
403 0.28
404 0.34
405 0.33
406 0.32
407 0.37
408 0.35
409 0.29
410 0.27
411 0.26
412 0.22
413 0.2
414 0.22
415 0.17
416 0.18
417 0.2
418 0.2
419 0.24
420 0.27
421 0.31
422 0.29
423 0.3
424 0.33
425 0.36
426 0.43
427 0.46
428 0.48
429 0.48
430 0.52
431 0.6
432 0.65
433 0.66
434 0.68
435 0.66
436 0.64
437 0.67
438 0.66
439 0.66
440 0.62
441 0.65
442 0.64
443 0.69
444 0.7
445 0.68
446 0.67
447 0.68
448 0.74
449 0.75
450 0.76
451 0.76
452 0.79
453 0.84
454 0.9
455 0.92
456 0.93
457 0.92
458 0.94
459 0.94
460 0.94
461 0.89
462 0.86
463 0.85
464 0.79
465 0.74
466 0.66
467 0.62
468 0.54
469 0.52
470 0.48
471 0.42
472 0.41
473 0.4
474 0.48
475 0.46
476 0.49
477 0.51
478 0.5
479 0.54
480 0.56
481 0.55
482 0.56
483 0.6
484 0.57
485 0.57
486 0.59
487 0.55
488 0.52
489 0.49
490 0.41
491 0.41
492 0.45
493 0.45
494 0.42
495 0.39
496 0.38
497 0.4
498 0.39
499 0.31
500 0.32
501 0.3
502 0.33
503 0.34
504 0.31
505 0.28
506 0.28
507 0.31
508 0.27
509 0.24
510 0.22
511 0.26
512 0.28
513 0.3
514 0.32
515 0.29
516 0.27
517 0.28
518 0.3
519 0.27
520 0.29
521 0.3
522 0.3
523 0.28
524 0.31