Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WHI4

Protein Details
Accession A0A1Y2WHI4   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
134-155LELYQMSKPKPRGKTRRRREGPBasic
NLS Segment(s)
PositionSequence
103-120GRGRGMGGGRGGGRGRGR
141-155KPKPRGKTRRRREGP
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MDSSSPAGPQDPSSTVPPPVEPEVAGTSSAAQILQAPTSPAAAPPPPAPQSTIIILPELWEDLIEPGMFVSMSMWPMDRPPQSAAPLPPPVFAGPPMHPPFPGRGRGMGGGRGGGRGRGRGMAGVPTVSHSYPLELYQMSKPKPRGKTRRRREGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.26
5 0.26
6 0.27
7 0.25
8 0.21
9 0.21
10 0.22
11 0.21
12 0.2
13 0.16
14 0.13
15 0.13
16 0.13
17 0.09
18 0.06
19 0.08
20 0.08
21 0.09
22 0.08
23 0.09
24 0.09
25 0.1
26 0.1
27 0.09
28 0.11
29 0.11
30 0.13
31 0.13
32 0.18
33 0.19
34 0.2
35 0.21
36 0.2
37 0.22
38 0.21
39 0.21
40 0.16
41 0.15
42 0.14
43 0.12
44 0.11
45 0.08
46 0.07
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.06
64 0.11
65 0.11
66 0.12
67 0.14
68 0.16
69 0.18
70 0.21
71 0.21
72 0.21
73 0.26
74 0.24
75 0.22
76 0.21
77 0.19
78 0.17
79 0.17
80 0.16
81 0.12
82 0.2
83 0.23
84 0.22
85 0.22
86 0.23
87 0.27
88 0.28
89 0.32
90 0.25
91 0.24
92 0.25
93 0.29
94 0.29
95 0.26
96 0.22
97 0.19
98 0.18
99 0.18
100 0.16
101 0.17
102 0.17
103 0.16
104 0.17
105 0.16
106 0.17
107 0.16
108 0.17
109 0.16
110 0.15
111 0.14
112 0.13
113 0.14
114 0.16
115 0.15
116 0.16
117 0.13
118 0.14
119 0.15
120 0.16
121 0.15
122 0.14
123 0.16
124 0.21
125 0.29
126 0.31
127 0.37
128 0.45
129 0.51
130 0.6
131 0.69
132 0.73
133 0.76
134 0.84
135 0.88