Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W3H8

Protein Details
Accession A0A1Y2W3H8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-32IPTSADPRSKRPTKKRALTPLSAQHydrophilic
119-152KEERERRDDEKTRKNREKREKAKARKAKGKNGGEBasic
NLS Segment(s)
PositionSequence
121-161ERERRDDEKTRKNREKREKAKARKAKGKNGGEGGGNNGAGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSGEGPESIPTSADPRSKRPTKKRALTPLSAQAAEVDALFAKPEQEIRVPDPSSSSRKQQRNLPPPPEIVTNVQGSSAGAGSGEFHVYKASRRREYERLRRMDEEVAQERAEEVFEKTKEERERRDDEKTRKNREKREKAKARKAKGKNGGEGGGNNGAGKGGAANASNGKPAAASNGVKARLDVRRDEDKETEKKEDVEASTQDAPTNEPKGIVIEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.34
3 0.44
4 0.53
5 0.62
6 0.7
7 0.75
8 0.8
9 0.86
10 0.88
11 0.89
12 0.88
13 0.83
14 0.78
15 0.77
16 0.7
17 0.6
18 0.49
19 0.39
20 0.32
21 0.26
22 0.19
23 0.11
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.08
31 0.1
32 0.14
33 0.17
34 0.2
35 0.27
36 0.27
37 0.27
38 0.29
39 0.32
40 0.35
41 0.35
42 0.41
43 0.43
44 0.5
45 0.54
46 0.59
47 0.65
48 0.69
49 0.75
50 0.72
51 0.66
52 0.61
53 0.59
54 0.52
55 0.43
56 0.36
57 0.29
58 0.25
59 0.21
60 0.19
61 0.17
62 0.14
63 0.12
64 0.09
65 0.06
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.05
72 0.05
73 0.07
74 0.08
75 0.13
76 0.2
77 0.27
78 0.32
79 0.36
80 0.42
81 0.51
82 0.61
83 0.67
84 0.68
85 0.66
86 0.64
87 0.62
88 0.58
89 0.51
90 0.43
91 0.38
92 0.31
93 0.27
94 0.23
95 0.21
96 0.19
97 0.16
98 0.14
99 0.09
100 0.07
101 0.1
102 0.1
103 0.13
104 0.14
105 0.2
106 0.27
107 0.31
108 0.35
109 0.38
110 0.44
111 0.45
112 0.54
113 0.57
114 0.58
115 0.65
116 0.68
117 0.72
118 0.76
119 0.8
120 0.82
121 0.84
122 0.87
123 0.86
124 0.87
125 0.88
126 0.88
127 0.91
128 0.89
129 0.87
130 0.86
131 0.84
132 0.83
133 0.82
134 0.77
135 0.71
136 0.65
137 0.57
138 0.48
139 0.41
140 0.34
141 0.26
142 0.2
143 0.15
144 0.12
145 0.1
146 0.09
147 0.08
148 0.05
149 0.04
150 0.05
151 0.05
152 0.07
153 0.1
154 0.11
155 0.12
156 0.12
157 0.11
158 0.1
159 0.1
160 0.13
161 0.15
162 0.15
163 0.18
164 0.24
165 0.26
166 0.25
167 0.26
168 0.28
169 0.29
170 0.32
171 0.32
172 0.33
173 0.42
174 0.44
175 0.49
176 0.49
177 0.51
178 0.56
179 0.57
180 0.56
181 0.48
182 0.47
183 0.45
184 0.44
185 0.38
186 0.36
187 0.31
188 0.31
189 0.32
190 0.31
191 0.3
192 0.25
193 0.26
194 0.27
195 0.28
196 0.23
197 0.2
198 0.2
199 0.21