Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U806

Protein Details
Accession Q6U806    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-53LRFPSSCTKRSRKQEKGRRSRIGTSHydrophilic
NLS Segment(s)
PositionSequence
38-47RSRKQEKGRR
Subcellular Location(s) mito 10, extr 7, plas 5, nucl 1, cyto 1, cyto_nucl 1, pero 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MMKKSITLLLAAAPCFASPFLAKQGSCLLRFPSSCTKRSRKQEKGRRSRIGTSLASASSCFARKAVRSRSKQPSLLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.09
5 0.08
6 0.1
7 0.14
8 0.18
9 0.18
10 0.18
11 0.26
12 0.27
13 0.28
14 0.27
15 0.25
16 0.25
17 0.25
18 0.28
19 0.32
20 0.33
21 0.36
22 0.42
23 0.47
24 0.52
25 0.63
26 0.68
27 0.68
28 0.75
29 0.81
30 0.84
31 0.88
32 0.9
33 0.87
34 0.82
35 0.76
36 0.69
37 0.65
38 0.55
39 0.46
40 0.38
41 0.3
42 0.25
43 0.2
44 0.17
45 0.13
46 0.14
47 0.12
48 0.12
49 0.15
50 0.2
51 0.29
52 0.39
53 0.47
54 0.53
55 0.63
56 0.72
57 0.76
58 0.76