Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WC69

Protein Details
Accession A0A1Y2WC69   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41YVRHLIRSLRRRRTKPAEANHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 6, E.R. 5, mito 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLNNETIVGIVTLFLMCFLPYVRHLIRSLRRRRTKPAEANAITIDPIFRPDNLASLESGMLYATRSVRVETFMLRSNTVPDLHWTFYHRGSDLDRVNNVQALSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.08
8 0.09
9 0.15
10 0.16
11 0.19
12 0.2
13 0.28
14 0.36
15 0.45
16 0.54
17 0.58
18 0.67
19 0.69
20 0.77
21 0.79
22 0.8
23 0.8
24 0.78
25 0.77
26 0.68
27 0.66
28 0.56
29 0.47
30 0.36
31 0.27
32 0.19
33 0.08
34 0.1
35 0.09
36 0.08
37 0.1
38 0.1
39 0.12
40 0.13
41 0.13
42 0.1
43 0.1
44 0.1
45 0.08
46 0.08
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.07
53 0.08
54 0.08
55 0.09
56 0.11
57 0.12
58 0.12
59 0.15
60 0.19
61 0.2
62 0.21
63 0.21
64 0.21
65 0.22
66 0.21
67 0.19
68 0.18
69 0.21
70 0.22
71 0.23
72 0.24
73 0.25
74 0.28
75 0.3
76 0.26
77 0.24
78 0.26
79 0.33
80 0.34
81 0.36
82 0.35
83 0.35
84 0.36
85 0.36
86 0.33