Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W025

Protein Details
Accession A0A1Y2W025    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHVKPIRCSNCSHydrophilic
104-129RSRVGRRNRAPPPRVRYNKDGKKVTPBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
105-124SRVGRRNRAPPPRVRYNKDG
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFSEYTVPKMYLKLQYCVSCAIHGKIVRYVFSSREWTTRSSSGPAVRSRVGRRNRAPPPRVRYNKDGKKVTPTQTAKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.86
4 0.83
5 0.82
6 0.83
7 0.84
8 0.81
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.67
15 0.64
16 0.66
17 0.69
18 0.7
19 0.72
20 0.72
21 0.73
22 0.74
23 0.76
24 0.72
25 0.73
26 0.69
27 0.69
28 0.61
29 0.53
30 0.47
31 0.38
32 0.35
33 0.28
34 0.25
35 0.16
36 0.15
37 0.12
38 0.11
39 0.1
40 0.08
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.08
49 0.09
50 0.1
51 0.1
52 0.1
53 0.11
54 0.13
55 0.17
56 0.19
57 0.2
58 0.22
59 0.23
60 0.23
61 0.25
62 0.22
63 0.17
64 0.17
65 0.16
66 0.17
67 0.17
68 0.17
69 0.19
70 0.19
71 0.18
72 0.19
73 0.2
74 0.17
75 0.19
76 0.24
77 0.21
78 0.24
79 0.25
80 0.25
81 0.28
82 0.29
83 0.28
84 0.26
85 0.29
86 0.29
87 0.32
88 0.33
89 0.33
90 0.33
91 0.38
92 0.41
93 0.46
94 0.5
95 0.55
96 0.58
97 0.64
98 0.71
99 0.76
100 0.77
101 0.78
102 0.78
103 0.8
104 0.82
105 0.79
106 0.78
107 0.79
108 0.81
109 0.81
110 0.8
111 0.72
112 0.73
113 0.74
114 0.71
115 0.71
116 0.66