Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WHJ2

Protein Details
Accession A0A1Y2WHJ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-72CSIHVCTNYKRHRSRKNVIHLEFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 8, E.R. 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MARAYVITKIVATAERTIPTLFGVVQGPGREFWISCFPNRLMIFLDLIICSIHVCTNYKRHRSRKNVIHLEFYFYGGSCFLMSDIGTYVGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.19
5 0.18
6 0.16
7 0.15
8 0.11
9 0.1
10 0.1
11 0.09
12 0.11
13 0.11
14 0.11
15 0.11
16 0.12
17 0.11
18 0.1
19 0.12
20 0.19
21 0.19
22 0.19
23 0.23
24 0.21
25 0.28
26 0.28
27 0.27
28 0.2
29 0.19
30 0.19
31 0.15
32 0.15
33 0.08
34 0.08
35 0.07
36 0.05
37 0.04
38 0.04
39 0.05
40 0.06
41 0.08
42 0.11
43 0.21
44 0.29
45 0.39
46 0.48
47 0.57
48 0.66
49 0.73
50 0.81
51 0.8
52 0.83
53 0.84
54 0.78
55 0.77
56 0.67
57 0.64
58 0.55
59 0.47
60 0.36
61 0.26
62 0.24
63 0.15
64 0.15
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08