Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W1R5

Protein Details
Accession A0A1Y2W1R5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78QGGATRTEKKKRSPDNPQLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 5, extr 5, cyto 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MLFLLSLLSTVLRPFFLLSKGRVRKERMVCEIIPRGKVRGFAMWACGLALPLVLGAGSQGGATRTEKKKRSPDNPQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.14
4 0.17
5 0.2
6 0.3
7 0.37
8 0.42
9 0.47
10 0.51
11 0.56
12 0.61
13 0.64
14 0.6
15 0.58
16 0.52
17 0.52
18 0.53
19 0.46
20 0.42
21 0.35
22 0.31
23 0.27
24 0.28
25 0.24
26 0.18
27 0.18
28 0.15
29 0.17
30 0.15
31 0.14
32 0.12
33 0.11
34 0.09
35 0.07
36 0.06
37 0.03
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.07
49 0.09
50 0.18
51 0.27
52 0.36
53 0.42
54 0.51
55 0.61
56 0.69
57 0.77
58 0.8