Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WAA6

Protein Details
Accession A0A1Y2WAA6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
141-161GACIWRRKYLRKKDRMYELGKHydrophilic
196-217GTAGDNEKPKKERKKWTVTSRTHydrophilic
NLS Segment(s)
PositionSequence
204-210PKKERKK
Subcellular Location(s) extr 24, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAQPVTTVVPFTSLPSCAVRCGPLFDANGACVPPAAAQADATTYDQCFCSYDSLQAFSTGTAGVCDTACTDDAGGLGSIQGWFTSFCGEAAQATASSSSATSTSTSSSSNNSGGGGWVSTHWRWVIMIVIVVVGIAGIWIGACIWRRKYLRKKDRMYELGKGLPSNIAVNTQGNLVGPGARDSNYSNPGAFMSGSGTAGDNEKPKKERKKWTVTSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.21
4 0.21
5 0.22
6 0.22
7 0.21
8 0.24
9 0.25
10 0.26
11 0.26
12 0.26
13 0.26
14 0.24
15 0.24
16 0.2
17 0.16
18 0.11
19 0.1
20 0.08
21 0.09
22 0.09
23 0.08
24 0.08
25 0.09
26 0.1
27 0.11
28 0.12
29 0.11
30 0.1
31 0.11
32 0.11
33 0.12
34 0.12
35 0.11
36 0.14
37 0.14
38 0.18
39 0.19
40 0.21
41 0.2
42 0.2
43 0.19
44 0.15
45 0.15
46 0.1
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.06
89 0.06
90 0.07
91 0.08
92 0.09
93 0.09
94 0.11
95 0.12
96 0.12
97 0.11
98 0.11
99 0.1
100 0.09
101 0.08
102 0.06
103 0.05
104 0.05
105 0.08
106 0.07
107 0.09
108 0.08
109 0.09
110 0.08
111 0.09
112 0.09
113 0.06
114 0.07
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.03
121 0.02
122 0.02
123 0.01
124 0.01
125 0.01
126 0.01
127 0.02
128 0.04
129 0.06
130 0.1
131 0.12
132 0.19
133 0.23
134 0.33
135 0.44
136 0.54
137 0.63
138 0.7
139 0.76
140 0.77
141 0.84
142 0.82
143 0.76
144 0.71
145 0.64
146 0.58
147 0.51
148 0.43
149 0.34
150 0.27
151 0.22
152 0.18
153 0.14
154 0.11
155 0.12
156 0.12
157 0.12
158 0.11
159 0.11
160 0.1
161 0.1
162 0.09
163 0.08
164 0.08
165 0.09
166 0.1
167 0.1
168 0.12
169 0.14
170 0.2
171 0.23
172 0.23
173 0.22
174 0.21
175 0.21
176 0.21
177 0.18
178 0.12
179 0.11
180 0.11
181 0.11
182 0.11
183 0.11
184 0.1
185 0.12
186 0.15
187 0.2
188 0.23
189 0.29
190 0.35
191 0.44
192 0.54
193 0.62
194 0.71
195 0.74
196 0.81
197 0.85