Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0WW97

Protein Details
Accession J0WW97    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
46-71EKLYLNQFRKRNRSKQPKNQLGLLRPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 2, plas 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_116694  -  
Amino Acid Sequences MGLANVEMLQIGASHQNLGGEARYRHRRQLRTVDFKEGVPGLLGMEKLYLNQFRKRNRSKQPKNQLGLLRPQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.1
6 0.11
7 0.12
8 0.14
9 0.21
10 0.3
11 0.32
12 0.4
13 0.48
14 0.51
15 0.55
16 0.64
17 0.66
18 0.67
19 0.67
20 0.65
21 0.58
22 0.53
23 0.47
24 0.36
25 0.26
26 0.15
27 0.13
28 0.07
29 0.06
30 0.06
31 0.05
32 0.06
33 0.05
34 0.06
35 0.09
36 0.15
37 0.17
38 0.25
39 0.32
40 0.39
41 0.5
42 0.59
43 0.66
44 0.72
45 0.8
46 0.84
47 0.89
48 0.92
49 0.91
50 0.86
51 0.84
52 0.81
53 0.75