Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2VSQ6

Protein Details
Accession A0A1Y2VSQ6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-40SSTASRRNTNKLNTKKKKSSKSASQIKDKQHydrophilic
NLS Segment(s)
PositionSequence
24-31TKKKKSSK
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MHKRTLLNRISSTASRRNTNKLNTKKKKSSKSASQIKDKQGQPIEEGDKVWTKARGGRHEGQVEQVVRSAGEAEEAGVENPPKVLFQDQHGHGAAHNPGMLEHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.48
4 0.53
5 0.55
6 0.61
7 0.65
8 0.67
9 0.74
10 0.77
11 0.83
12 0.86
13 0.88
14 0.89
15 0.88
16 0.87
17 0.86
18 0.86
19 0.86
20 0.82
21 0.83
22 0.79
23 0.75
24 0.74
25 0.65
26 0.61
27 0.55
28 0.49
29 0.4
30 0.38
31 0.35
32 0.27
33 0.26
34 0.2
35 0.18
36 0.18
37 0.18
38 0.14
39 0.13
40 0.16
41 0.21
42 0.25
43 0.3
44 0.33
45 0.37
46 0.39
47 0.38
48 0.37
49 0.36
50 0.31
51 0.24
52 0.21
53 0.15
54 0.13
55 0.12
56 0.11
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.07
67 0.08
68 0.08
69 0.07
70 0.09
71 0.13
72 0.13
73 0.18
74 0.27
75 0.28
76 0.33
77 0.34
78 0.32
79 0.28
80 0.32
81 0.28
82 0.21
83 0.19
84 0.15