Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2VNM7

Protein Details
Accession A0A1Y2VNM7    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MGPSDKCPPPKLRSKTKSRRIHKRKKGPLRSDGKLKQBasic
121-162QCLPKPAPIKPPPKKGRKPHPHNNAAERRLRKRRFREDVTTIBasic
NLS Segment(s)
PositionSequence
10-34PKLRSKTKSRRIHKRKKGPLRSDGK
125-155KPAPIKPPPKKGRKPHPHNNAAERRLRKRRF
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGPSDKCPPPKLRSKTKSRRIHKRKKGPLRSDGKLKQTVLRRPLQDLGCNKQLKFAVPRSSDSDDKDKSHPTVPRHYSKDHDHKQKSQDVSASDDGESLEGTKAGDIPIVSSSLPEGAKTQCLPKPAPIKPPPKKGRKPHPHNNAAERRLRKRRFREDVTTIEILNPELLMEAGIIDPNLYLERAGLSTPGYLAELRSDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.87
4 0.9
5 0.9
6 0.92
7 0.92
8 0.94
9 0.94
10 0.94
11 0.95
12 0.95
13 0.96
14 0.93
15 0.92
16 0.89
17 0.85
18 0.84
19 0.79
20 0.76
21 0.71
22 0.63
23 0.59
24 0.59
25 0.61
26 0.57
27 0.57
28 0.52
29 0.5
30 0.55
31 0.51
32 0.5
33 0.47
34 0.46
35 0.48
36 0.48
37 0.44
38 0.42
39 0.41
40 0.38
41 0.38
42 0.39
43 0.39
44 0.38
45 0.42
46 0.42
47 0.46
48 0.44
49 0.42
50 0.43
51 0.37
52 0.38
53 0.38
54 0.35
55 0.33
56 0.36
57 0.38
58 0.35
59 0.42
60 0.45
61 0.5
62 0.51
63 0.51
64 0.51
65 0.54
66 0.61
67 0.6
68 0.64
69 0.61
70 0.63
71 0.66
72 0.67
73 0.61
74 0.52
75 0.46
76 0.36
77 0.36
78 0.32
79 0.27
80 0.2
81 0.18
82 0.16
83 0.13
84 0.11
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.04
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.07
103 0.08
104 0.08
105 0.1
106 0.11
107 0.16
108 0.15
109 0.19
110 0.2
111 0.25
112 0.33
113 0.35
114 0.44
115 0.48
116 0.57
117 0.62
118 0.72
119 0.75
120 0.77
121 0.83
122 0.84
123 0.86
124 0.87
125 0.88
126 0.88
127 0.89
128 0.88
129 0.85
130 0.85
131 0.83
132 0.77
133 0.75
134 0.72
135 0.71
136 0.72
137 0.75
138 0.75
139 0.76
140 0.81
141 0.83
142 0.83
143 0.82
144 0.78
145 0.74
146 0.7
147 0.61
148 0.5
149 0.42
150 0.35
151 0.26
152 0.19
153 0.14
154 0.07
155 0.06
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.04
165 0.05
166 0.06
167 0.06
168 0.06
169 0.06
170 0.08
171 0.08
172 0.09
173 0.09
174 0.09
175 0.09
176 0.09
177 0.1
178 0.1
179 0.1
180 0.1