Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W8T0

Protein Details
Accession A0A1Y2W8T0    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-64DGPWRRKVDKIKKDLIHKAKVKKAYKKIKAAEBasic
122-149EPAGDQPPRQRRQRQKQKARRPGYFDKAHydrophilic
NLS Segment(s)
PositionSequence
18-61KKLRKGFRVGPQNLPDGPWRRKVDKIKKDLIHKAKVKKAYKKIK
129-220PRQRRQRQKQKARRPGYFDKAVADAERKKAEADARAQEIERRNAERNRKLEERERFRKALTKARAPGRDGKRKLGRESGLLLEKARKLVGGK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAPKRPLESDSATTPAAKKLRKGFRVGPQNLPDGPWRRKVDKIKKDLIHKAKVKKAYKKIKAAEQASSNPENATVTEAKDAEAGAEADVDAPAPPSPKLHPERQARLDADEEEEEEPEPEPEPAGDQPPRQRRQRQKQKARRPGYFDKAVADAERKKAEADARAQEIERRNAERNRKLEERERFRKALTKARAPGRDGKRKLGRESGLLLEKARKLVGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.35
4 0.33
5 0.36
6 0.43
7 0.53
8 0.56
9 0.62
10 0.63
11 0.66
12 0.74
13 0.72
14 0.71
15 0.64
16 0.63
17 0.56
18 0.5
19 0.48
20 0.45
21 0.45
22 0.46
23 0.48
24 0.47
25 0.55
26 0.64
27 0.68
28 0.7
29 0.74
30 0.74
31 0.74
32 0.79
33 0.8
34 0.78
35 0.77
36 0.74
37 0.74
38 0.71
39 0.75
40 0.75
41 0.75
42 0.77
43 0.78
44 0.79
45 0.8
46 0.78
47 0.77
48 0.77
49 0.7
50 0.65
51 0.58
52 0.53
53 0.49
54 0.45
55 0.37
56 0.27
57 0.25
58 0.2
59 0.16
60 0.16
61 0.12
62 0.11
63 0.13
64 0.13
65 0.13
66 0.12
67 0.12
68 0.08
69 0.08
70 0.07
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.06
82 0.07
83 0.09
84 0.17
85 0.21
86 0.26
87 0.35
88 0.41
89 0.47
90 0.5
91 0.53
92 0.46
93 0.43
94 0.39
95 0.3
96 0.25
97 0.19
98 0.16
99 0.11
100 0.11
101 0.09
102 0.08
103 0.08
104 0.06
105 0.07
106 0.05
107 0.05
108 0.05
109 0.06
110 0.07
111 0.11
112 0.12
113 0.15
114 0.23
115 0.33
116 0.39
117 0.45
118 0.54
119 0.61
120 0.71
121 0.8
122 0.83
123 0.85
124 0.9
125 0.93
126 0.95
127 0.92
128 0.86
129 0.83
130 0.81
131 0.77
132 0.71
133 0.6
134 0.51
135 0.44
136 0.39
137 0.32
138 0.28
139 0.24
140 0.23
141 0.23
142 0.22
143 0.21
144 0.23
145 0.25
146 0.25
147 0.28
148 0.28
149 0.3
150 0.31
151 0.31
152 0.33
153 0.34
154 0.35
155 0.34
156 0.34
157 0.38
158 0.44
159 0.54
160 0.57
161 0.57
162 0.59
163 0.6
164 0.62
165 0.65
166 0.68
167 0.68
168 0.69
169 0.71
170 0.66
171 0.62
172 0.64
173 0.61
174 0.6
175 0.58
176 0.58
177 0.59
178 0.66
179 0.69
180 0.65
181 0.69
182 0.69
183 0.72
184 0.67
185 0.69
186 0.7
187 0.71
188 0.73
189 0.72
190 0.65
191 0.58
192 0.58
193 0.54
194 0.5
195 0.45
196 0.41
197 0.38
198 0.37
199 0.35
200 0.31