Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2VZR2

Protein Details
Accession A0A1Y2VZR2   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
105-130AEGTPTKKPRAKKVLKKPKKDSSSDEBasic
NLS Segment(s)
PositionSequence
86-93RGRKRKSD
103-124AEAEGTPTKKPRAKKVLKKPKK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 4, extr 4
Family & Domain DBs
Amino Acid Sequences MTSPTKSALTQREIEVTAMAWLCITALKDGIPQVDCKRLAQIGNYASPDSARHSWKPIERKLATLASAQDGDGGAVTPVKPTTTGRGRKRKSDTNGGSGGGGAEAEGTPTKKPRAKKVLKKPKKDSSSDELSDLRDSDFDDGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.21
4 0.19
5 0.15
6 0.13
7 0.09
8 0.08
9 0.07
10 0.08
11 0.09
12 0.07
13 0.07
14 0.08
15 0.09
16 0.11
17 0.13
18 0.13
19 0.16
20 0.18
21 0.24
22 0.25
23 0.24
24 0.26
25 0.26
26 0.26
27 0.24
28 0.27
29 0.22
30 0.25
31 0.25
32 0.23
33 0.2
34 0.19
35 0.18
36 0.18
37 0.19
38 0.2
39 0.2
40 0.24
41 0.29
42 0.34
43 0.42
44 0.42
45 0.48
46 0.44
47 0.44
48 0.44
49 0.41
50 0.36
51 0.3
52 0.25
53 0.17
54 0.16
55 0.14
56 0.1
57 0.09
58 0.07
59 0.05
60 0.05
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.06
69 0.13
70 0.22
71 0.31
72 0.4
73 0.51
74 0.54
75 0.62
76 0.68
77 0.71
78 0.68
79 0.7
80 0.64
81 0.6
82 0.58
83 0.5
84 0.43
85 0.34
86 0.27
87 0.16
88 0.12
89 0.05
90 0.04
91 0.03
92 0.04
93 0.06
94 0.07
95 0.09
96 0.13
97 0.2
98 0.24
99 0.3
100 0.39
101 0.5
102 0.59
103 0.69
104 0.77
105 0.81
106 0.87
107 0.93
108 0.92
109 0.91
110 0.89
111 0.84
112 0.8
113 0.76
114 0.75
115 0.66
116 0.6
117 0.51
118 0.45
119 0.4
120 0.33
121 0.26
122 0.18
123 0.17
124 0.16