Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W8J1

Protein Details
Accession A0A1Y2W8J1    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-42NQLTRWIYPQRRLKCHRKPPPGPQDTNPHydrophilic
46-74NPLLDTAKKKSKKNRCKQKRTEKGPNADQHydrophilic
126-148SGTYNKPPFRKKMKILSRSRAACHydrophilic
NLS Segment(s)
PositionSequence
53-67KKKSKKNRCKQKRTE
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MPSYPSARKQTRSINQLTRWIYPQRRLKCHRKPPPGPQDTNPLWPNPLLDTAKKKSKKNRCKQKRTEKGPNADQVQPRGKTLLFLFSFTPRNRKEEQEEKKRNMHNPYQLQGLTIPPFLWPLYPTSGTYNKPPFRKKMKILSRSRAACLPVVHRIRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.71
4 0.68
5 0.6
6 0.56
7 0.57
8 0.55
9 0.55
10 0.6
11 0.6
12 0.67
13 0.73
14 0.79
15 0.8
16 0.86
17 0.87
18 0.88
19 0.88
20 0.89
21 0.91
22 0.89
23 0.83
24 0.75
25 0.73
26 0.65
27 0.64
28 0.55
29 0.44
30 0.36
31 0.31
32 0.29
33 0.21
34 0.24
35 0.19
36 0.21
37 0.27
38 0.32
39 0.41
40 0.46
41 0.51
42 0.56
43 0.65
44 0.72
45 0.76
46 0.82
47 0.84
48 0.89
49 0.93
50 0.95
51 0.94
52 0.93
53 0.93
54 0.89
55 0.86
56 0.8
57 0.75
58 0.67
59 0.61
60 0.53
61 0.47
62 0.45
63 0.38
64 0.33
65 0.28
66 0.24
67 0.21
68 0.19
69 0.21
70 0.15
71 0.16
72 0.17
73 0.18
74 0.24
75 0.24
76 0.31
77 0.26
78 0.3
79 0.32
80 0.35
81 0.39
82 0.44
83 0.53
84 0.57
85 0.64
86 0.64
87 0.69
88 0.7
89 0.69
90 0.66
91 0.63
92 0.61
93 0.58
94 0.55
95 0.52
96 0.46
97 0.41
98 0.35
99 0.3
100 0.22
101 0.17
102 0.15
103 0.11
104 0.12
105 0.11
106 0.11
107 0.09
108 0.11
109 0.15
110 0.16
111 0.18
112 0.22
113 0.27
114 0.28
115 0.36
116 0.43
117 0.45
118 0.52
119 0.57
120 0.61
121 0.66
122 0.73
123 0.73
124 0.75
125 0.79
126 0.81
127 0.84
128 0.84
129 0.84
130 0.79
131 0.74
132 0.67
133 0.59
134 0.53
135 0.47
136 0.42
137 0.42