Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W3P4

Protein Details
Accession A0A1Y2W3P4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-78IHYATMKPEQKKKKEPKKDNKKPEGKTVEREBasic
NLS Segment(s)
PositionSequence
56-79EQKKKKEPKKDNKKPEGKTVEREK
Subcellular Location(s) mito 8, cyto 6, E.R. 6, plas 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGQFGFMAKIGATNEAVAVLNDQPYIFTILVVILVILILQSVFIWYIHYATMKPEQKKKKEPKKDNKKPEGKTVEREKGGNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.1
5 0.08
6 0.09
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.08
13 0.11
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.01
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.06
38 0.09
39 0.18
40 0.24
41 0.29
42 0.38
43 0.47
44 0.55
45 0.66
46 0.74
47 0.77
48 0.82
49 0.88
50 0.9
51 0.92
52 0.95
53 0.95
54 0.95
55 0.94
56 0.88
57 0.87
58 0.86
59 0.8
60 0.79
61 0.78
62 0.76
63 0.69