Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2VPB6

Protein Details
Accession A0A1Y2VPB6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-41GALKLKGGKVQKTKKKKKSKAPDLELERABasic
NLS Segment(s)
PositionSequence
16-33KLKGGKVQKTKKKKKSKA
Subcellular Location(s) nucl 20, cyto_nucl 13.833, mito_nucl 11.999, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYVSIGGGGALKLKGGKVQKTKKKKKSKAPDLELERALSESAGESSSTKEAEKKRQDSDKGDNDEDVTEQKTEAERKYEEANKKKLLKMLEDPKVASDFRKTHKERVEGLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.14
6 0.19
7 0.28
8 0.36
9 0.47
10 0.57
11 0.68
12 0.78
13 0.83
14 0.89
15 0.91
16 0.91
17 0.92
18 0.93
19 0.93
20 0.89
21 0.88
22 0.84
23 0.8
24 0.7
25 0.59
26 0.48
27 0.37
28 0.29
29 0.19
30 0.12
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.09
38 0.09
39 0.09
40 0.14
41 0.19
42 0.28
43 0.36
44 0.39
45 0.44
46 0.5
47 0.54
48 0.55
49 0.58
50 0.56
51 0.53
52 0.49
53 0.43
54 0.36
55 0.32
56 0.27
57 0.2
58 0.13
59 0.08
60 0.07
61 0.08
62 0.1
63 0.13
64 0.13
65 0.16
66 0.15
67 0.17
68 0.23
69 0.3
70 0.37
71 0.42
72 0.47
73 0.51
74 0.55
75 0.55
76 0.53
77 0.49
78 0.44
79 0.46
80 0.48
81 0.48
82 0.46
83 0.44
84 0.41
85 0.41
86 0.37
87 0.29
88 0.27
89 0.25
90 0.29
91 0.39
92 0.41
93 0.48
94 0.55
95 0.59
96 0.58
97 0.61
98 0.64
99 0.56
100 0.54
101 0.53
102 0.46
103 0.42
104 0.38
105 0.29
106 0.22
107 0.21
108 0.22
109 0.21
110 0.23
111 0.28
112 0.33
113 0.34