Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2WI95

Protein Details
Accession A0A1Y2WI95    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-29DPPPKEVSRVWWRKKRCQRNTTGPAANSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, mito 8, cyto_nucl 7, nucl 4.5, pero 3
Family & Domain DBs
Amino Acid Sequences MDPPPKEVSRVWWRKKRCQRNTTGPAANSHLFQVPNFRFLLLTLVHVHWLVLPTPSTLPVSQRFVRLPLFIWAHPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.86
3 0.88
4 0.87
5 0.86
6 0.86
7 0.88
8 0.88
9 0.85
10 0.8
11 0.7
12 0.62
13 0.56
14 0.47
15 0.36
16 0.3
17 0.23
18 0.18
19 0.17
20 0.22
21 0.18
22 0.2
23 0.19
24 0.18
25 0.15
26 0.15
27 0.18
28 0.1
29 0.11
30 0.1
31 0.1
32 0.11
33 0.11
34 0.11
35 0.09
36 0.09
37 0.08
38 0.07
39 0.08
40 0.09
41 0.09
42 0.11
43 0.13
44 0.12
45 0.16
46 0.2
47 0.26
48 0.27
49 0.31
50 0.31
51 0.31
52 0.33
53 0.3
54 0.28
55 0.28
56 0.31