Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W942

Protein Details
Accession A0A1Y2W942    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-96GTISRMRRRLRDLGKRSRKKKBasic
NLS Segment(s)
PositionSequence
5-12PRRRRRSG
78-96ISRMRRRLRDLGKRSRKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences GPSPPRRRRRSGTGLDALFRRLRLGRSRDRQQERERQTRSPSGPAPGPVVPTGPAAIVRPPNPSPPGSEDSSRPPGTISRMRRRLRDLGKRSRKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.66
3 0.59
4 0.52
5 0.43
6 0.34
7 0.28
8 0.21
9 0.24
10 0.29
11 0.36
12 0.43
13 0.5
14 0.6
15 0.67
16 0.73
17 0.76
18 0.76
19 0.79
20 0.77
21 0.78
22 0.72
23 0.66
24 0.64
25 0.63
26 0.57
27 0.52
28 0.45
29 0.38
30 0.35
31 0.32
32 0.3
33 0.23
34 0.21
35 0.16
36 0.15
37 0.12
38 0.11
39 0.1
40 0.07
41 0.07
42 0.07
43 0.09
44 0.12
45 0.12
46 0.16
47 0.17
48 0.22
49 0.24
50 0.24
51 0.24
52 0.27
53 0.3
54 0.29
55 0.3
56 0.28
57 0.32
58 0.39
59 0.36
60 0.31
61 0.28
62 0.27
63 0.32
64 0.39
65 0.42
66 0.45
67 0.55
68 0.6
69 0.65
70 0.69
71 0.73
72 0.74
73 0.76
74 0.75
75 0.76
76 0.83