Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LHW7

Protein Details
Accession E2LHW7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-50ISIKDSPKKDHSSKNKDKSRDRDKHNHRDKDRKRRKRDESSQLADSBasic
NLS Segment(s)
PositionSequence
11-41PKKDHSSKNKDKSRDRDKHNHRDKDRKRRKR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013633  NRDE-2  
Gene Ontology GO:0005634  C:nucleus  
KEGG mpr:MPER_06116  -  
Amino Acid Sequences MTANISIKDSPKKDHSSKNKDKSRDRDKHNHRDKDRKRRKRDESSQLADSGDTSPRGSDNTSRYFYSDWKGDPLNIQYGGIHKGNIPRYTVVNRGRKILGLPFGWSAFARNDQGIVVGKDRHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.79
5 0.83
6 0.84
7 0.84
8 0.87
9 0.87
10 0.87
11 0.85
12 0.83
13 0.84
14 0.86
15 0.88
16 0.89
17 0.89
18 0.86
19 0.88
20 0.89
21 0.89
22 0.9
23 0.9
24 0.9
25 0.9
26 0.92
27 0.92
28 0.92
29 0.91
30 0.89
31 0.83
32 0.74
33 0.64
34 0.54
35 0.43
36 0.34
37 0.24
38 0.16
39 0.11
40 0.09
41 0.08
42 0.08
43 0.09
44 0.1
45 0.13
46 0.16
47 0.2
48 0.22
49 0.22
50 0.23
51 0.23
52 0.23
53 0.22
54 0.2
55 0.16
56 0.16
57 0.17
58 0.16
59 0.17
60 0.17
61 0.17
62 0.15
63 0.15
64 0.13
65 0.14
66 0.17
67 0.15
68 0.13
69 0.12
70 0.18
71 0.23
72 0.24
73 0.25
74 0.23
75 0.26
76 0.29
77 0.36
78 0.39
79 0.42
80 0.42
81 0.44
82 0.43
83 0.4
84 0.39
85 0.36
86 0.32
87 0.24
88 0.26
89 0.24
90 0.23
91 0.24
92 0.22
93 0.19
94 0.16
95 0.19
96 0.19
97 0.17
98 0.18
99 0.16
100 0.19
101 0.2
102 0.2
103 0.2